(data stored in ACNUC1104 zone)

EMBL: CP000717.PE426

CP000717.PE426       Location/Qualifiers
FT   CDS_pept        complement(510302..510931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10426"
FT                   /old_locus_tag="TBFG_00418"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0421c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10426"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04769"
FT                   /protein_id="ABR04769.1"
FT                   /translation="MNLDQIAGVAHQPAGPPHGVVVLTHGAGGSRESTLLQQVCAEWTR
FT                   RGWLAVRYNLPYRRRRPTGPPSGSGSGDRAGIVEAIQLCRGLAEGPLIAGGHSYGGRQT
FT                   SMVVAAGQAPVDVLTLFSYPVHPPGKPERVRTEHLPGIAVPTVFTHGTADPFGTLAQVR
FT                   SAAAMVSAPTEVVEITGARHDLGSKTLDVARLAVDAALRLSAGQIA"
     atgaaccttg atcagatcgc cggcgttgca caccaaccgg ccggcccacc acacggggta        60
     gtcgtcctta cccacggcgc gggcggtagc cgcgaatcca cactgttgca acaggtttgc       120
     gccgaatgga cccgccgagg atggctggcc gtgcgctaca acctgcccta ccgccgacgc       180
     cgacccaccg gtccgccatc cggctcgggg tcaggcgacc gtgccggcat cgtcgaagcg       240
     atccagctgt gccgcggcct tgccgagggt ccgctgatcg ccgggggaca ttcctacggc       300
     ggtcggcaga cgtccatggt ggtggcggcc gggcaggcac cggtcgacgt gctgacgctg       360
     ttctcctatc cggtccatcc gccgggaaag ccggaacgcg tccgtaccga gcacttgccg       420
     gggatcgcag tgccgacggt gttcacccac ggaacggcgg acccgttcgg cacgctggcc       480
     caggtgcgtt ccgccgcggc gatggtctcg gcaccgaccg aggtcgtcga gatcaccggc       540
     gcccgacatg acttgggctc gaagaccctc gatgtcgcca ggctggcggt cgatgcggcg       600
     ctacgtctgt cggcgggcca aatagcgtga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page