(data stored in ACNUC1104 zone)

EMBL: CP000717.PE429

CP000717.PE429       Location/Qualifiers
FT   CDS_pept        complement(513547..513822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10429"
FT                   /old_locus_tag="TBFG_00421"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0424c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10429"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04772"
FT                   /protein_id="ABR04772.1"
FT                   /translation="MAEKNTRRATSQREAVAKIREAETIVMNLPICGQVKIPRPEHLAY
FT                   YGGLAALAALELIDWPVALVIATGHILANNHHNRVLEELGEAMEEA"
     atggccgaaa agaatacgcg tcgagcgaca tctcagcgtg aggccgtggc taagatccgc        60
     gaagcggaga ctattgtgat gaacctcccg atctgcggcc aagtgaagat tccgcggcca       120
     gagcacctgg cctactacgg aggtctggcg gcactcgctg ccctcgaact catcgactgg       180
     ccggtcgccc tggttatcgc caccggacat atcttggcaa ataaccacca caaccgggtc       240
     ctcgaggaac tcggcgaggc gatggaagag gcctaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page