(data stored in ACNUC1104 zone)

EMBL: CP000717.PE434

CP000717.PE434       Location/Qualifiers
FT   CDS_pept        complement(520973..521566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10434"
FT                   /old_locus_tag="TBFG_00426"
FT                   /product="polypeptide deformylase def (formylmethionine
FT                   deformylase)"
FT                   /note="Mapped to H37Rv Rv0429c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10434"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04777"
FT                   /protein_id="ABR04777.1"
FT                   /translation="MAVVPIRIVGDPVLHTATTPVTVAADGSLPADLAQLIATMYDTMD
FT                   AANGVGLAANQIGCSLRLFVYDCAADRAMTARRRGVVINPVLETSEIPETMPDPDTDDE
FT                   GCLSVPGESFPTGRAKWARVTGLDADGSPVSIEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRYARNAKRAVKSHGWGVPGLSWLPGEDPDPFGH"
     atggcagtcg tacccatccg catcgtgggc gatcccgtct tacacactgc gaccacaccg        60
     gtgacggtcg ccgccgacgg ttcactcccg gcggatctcg cccagttgat cgccaccatg       120
     tacgacacca tggacgccgc caacggagtc ggcctggctg ccaaccagat cggctgcagc       180
     ctgcggctct tcgtctacga ttgcgccgcg gaccgcgcaa tgaccgcccg ccgacgcggt       240
     gtggtcatca atccggtgct tgagacctcc gaaatacctg agaccatgcc cgacccggac       300
     accgacgacg aaggctgtct gtcggttccc ggcgagtcat ttcctaccgg acgcgcgaag       360
     tgggcacgag tcaccggact cgacgccgat ggcagtccgg tcagtatcga gggcaccggc       420
     ctgttcgcgc ggatgctgca gcacgaaacc gggcaccttg atggattcct gtacctggac       480
     cgcctcatcg gccggtacgc ccgcaacgcc aaacgggccg tcaagtcaca tggctggggc       540
     gttcccggac tgtcgtggct gcccggcgag gaccccgacc cgttcggtca ctaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page