(data stored in ACNUC1104 zone)

EMBL: CP000717.PE436

CP000717.PE436       Location/Qualifiers
FT   CDS_pept        522243..522737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10436"
FT                   /old_locus_tag="TBFG_00428"
FT                   /product="hypothetical tuberculin related peptide"
FT                   /note="Mapped to H37Rv Rv0431"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04779"
FT                   /protein_id="ABR04779.1"
FT                   /translation="MLVTVGSMNERVPDSSGLPLRAMVMVLLFLGVVFLLLVWQALGSS
FT                   PNSEDDSSAISTMTTTTAAPTSTSVKPAAPRAEVRVYNISGTEGAAARTADRLKAAGFT
FT                   VTDVGNLSLPDVAATTVYYTEVEGERATADAVGRTLGAAVELRLPELSDQPPGVIVVVT
FT                   G"
     gtgctggtta cagtgggctc gatgaatgag cgtgtacccg actcttccgg gcttcccctg        60
     cgggccatgg tgatggtgct gttgtttctc ggcgtcgtct tcctgctgct cgtctggcag       120
     gcactgggtt cgtctccgaa ctccgaggac gactcgtcag cgatttccac catgaccacc       180
     accactgcgg cgccgacgtc gaccagcgtt aagcccgcgg cgccccgggc cgaggtgcgc       240
     gtctacaaca tctcaggcac agaaggcgcc gccgcgcgga cggccgatcg gctcaaggcg       300
     gccggtttca cggtcaccga cgttgggaat ctatcgttac ccgacgtcgc ggcgaccacg       360
     gtgtactaca ccgaagtcga aggcgaacgg gccaccgccg acgcggtagg ccggacgcta       420
     ggagcagcgg tggagctgcg actgccagag ctgtccgacc agccgcccgg ggtcatcgtc       480
     gtggtgaccg gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page