(data stored in ACNUC1104 zone)

EMBL: CP000717.PE439

CP000717.PE439       Location/Qualifiers
FT   CDS_pept        524684..525337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10439"
FT                   /old_locus_tag="TBFG_00431"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0434"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10439"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04782"
FT                   /protein_id="ABR04782.1"
FT                   /translation="MADFAPVELAMFPLESAPLPDEDLPLHIFEPRYAALVRDCMDTAD
FT                   PRFGVVLISRGREVGGGDTRCDVGTLARITECADAGSGRYMLRCRVGERIRVCDWLPDD
FT                   PYPRAKVRFWPDQPGHPVTAAQLLEVEDRVVALFERIAAARGVRLPAREVVLGYPVVDP
FT                   ADTGQRLYALACRVPMGPADRYAVLATPSAADRLVRLGDALDSVAAMVEFELST"
     atggccgatt tcgcgccggt tgagttggcg atgttcccgc tcgagtcggc gccgctgccc        60
     gacgaagatc tgccgttgca catctttgag ccccgctacg cggcgctggt ccgtgactgc       120
     atggacaccg cggatcctcg cttcggtgtt gtactgatct cgcgtggccg cgaggtcggc       180
     ggcggcgata cgcgatgtga tgtcgggacg ctggccagga tcaccgaatg cgcggacgcg       240
     ggttcgggtc gctatatgct gcgctgccgg gtgggcgaac ggatccgggt gtgcgactgg       300
     ctgcccgacg atccgtaccc gcgtgcgaag gtacggttct ggcccgacca gccggggcac       360
     ccagtgacgg ctgcccagct gctggaagtc gaagaccggg ttgtggcgct attcgagcgg       420
     atcgctgccg cccggggagt tcggctgccg gcccgtgagg tggtattggg ctacccggtg       480
     gttgacccag ccgataccgg gcagcgtctg tacgcgctgg catgtcgagt gccgatgggc       540
     ccggccgatc ggtacgccgt gctggcgacg ccgtcggcgg ccgatcgatt ggtccgcttg       600
     ggtgacgcgc tggactcggt ggccgcgatg gtggagttcg agttgtcgac gtaa             654
//

If you have problems or comments...

PBIL Back to PBIL home page