(data stored in ACNUC1104 zone)

EMBL: CP000717.PE446

CP000717.PE446       Location/Qualifiers
FT   CDS_pept        complement(533466..533852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10446"
FT                   /old_locus_tag="TBFG_00438"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0441c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04789"
FT                   /protein_id="ABR04789.1"
FT                   /translation="MPDYPFAYLITVDDGHRVHTVAVEPVLRELPDGPDGPRAVVDVGL
FT                   IGGRTRQNLAHRSEVTLLWPPSDPSGYSLIVDGRAQASDAGPDDDTARCGVVPIRALLH
FT                   RDAAPDSPTAAKGCLHDCVVFSVP"
     ttgcccgact acccgttcgc ttacctgatc accgtcgatg atggccatcg cgtgcacacg        60
     gtggcagtcg agccggtgct gcgcgaactc cccgacggcc ccgatggacc ccgggcagtg       120
     gtcgacgtcg gcctgatcgg gggtcgtacg cggcaaaacc tggcccaccg cagcgaagtc       180
     accctgttgt ggccgccatc cgatcctagc ggctactcgc tgatcgtcga cggccgtgcc       240
     caggcgtcgg acgcaggccc cgatgacgac accgcccgct gcggtgtcgt acccatccgc       300
     gcgctgctgc accgagacgc ggcccccgac tcgcccacag cggccaaagg ttgcctacac       360
     gactgcgtgg tgttctcggt accgtag                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page