(data stored in ACNUC1104 zone)

EMBL: CP000717.PE454

CP000717.PE454       Location/Qualifiers
FT   CDS_pept        complement(539673..540404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10454"
FT                   /old_locus_tag="TBFG_00445"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0448c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10454"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04797"
FT                   /protein_id="ABR04797.1"
FT                   /translation="MLTQTLTPAIYRTTISHCRQVPVHHSFAYRSYSWYVDVDNLPQLP
FT                   WWLRPFARFHADDHFADPFSCPPHSSLRDRLDAFFAARGLAVPDGRITALLQARVLGYV
FT                   FNPLSIFWCHDRDGQLRHVIAEVHNTYGGRHAYLLPPADLPVVTAKNFYVSPFHQLAGY
FT                   YLIRAPRPDRELDVTVTLHRDRRQVCPEFTATLRGQRRPATTRQIAMMQIISPLAPMVV
FT                   AARIRIQGIRLWLRRVPVVPR"
     gtgctgactc aaaccctgac gccggcgatc taccgcacca cgatcagcca ctgcagacaa        60
     gtcccggtgc accactcgtt cgcataccgc agctacagct ggtacgtgga tgtcgacaac       120
     ctcccccagc tgccctggtg gctgcgaccg ttcgcacggt tccacgccga cgaccacttc       180
     gctgacccgt tctcgtgtcc gccgcatagc tcgctgcgtg accggctgga cgccttcttt       240
     gccgctcgcg gccttgccgt ccccgacggc cgtatcaccg cgctgctgca agcacgcgtt       300
     ctcggctatg tcttcaaccc gttgagcatc ttctggtgcc acgaccgcga cggccaactg       360
     cgccatgtca ttgccgaggt gcacaacacc tacggcggac gccatgctta cctgctaccg       420
     ccggccgacc tgcccgtggt gacggccaag aacttctacg tttcgccgtt tcatcagcta       480
     gccggctact acctgatacg ggcaccacgg cccgaccgcg aactcgacgt cacggtgacg       540
     ctgcaccgtg accgccggca ggtgtgcccg gaattcacag ccaccctgcg tgggcagcgg       600
     cgaccggcaa cgacaagaca gatcgcgatg atgcaaatca tttcaccgct ggcgccgatg       660
     gtggtggccg cgcgcatcag gatacagggg atcagactgt ggctacgtcg agttccggtg       720
     gtgccgcgat ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page