(data stored in ACNUC1104 zone)

EMBL: CP000717.PE459

CP000717.PE459       Location/Qualifiers
FT   CDS_pept        546343..547899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10459"
FT                   /old_locus_tag="TBFG_00450"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0453"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10459"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04802"
FT                   /protein_id="ABR04802.1"
FT                   /translation="MTSALIWMASPPEVHSALLSSGPGPGPVLAAATGWSSLGREYAAV
FT                   AEELGALLAAVQAGVWQGPSAESFAAACLPYLSWLTQASADCAAAAARLEAVTAAYAAA
FT                   LVAMPTLAELAANHATHGAMVATNFFGINTIPIAVNEADYVRMWLQAATTMATYQAVAD
FT                   SAVRSIPDSVPPPRILKSNAQSQHSSSNNSGGADPVDDFIAEILKIITGGRVIWDPEAG
FT                   TVNGLPYDAYTNPGTLMWWIARSLELLQDFQEFAKLLFTNPVKAFQFLVDLILFDWPTH
FT                   MLQLATWLAENPQLLVAALTPAISGLGAVSGLAGLTGLVPQPPVVPAPAPDAVVPTVLP
FT                   LAGTATPTTAPASAPAAGAAPGPPAGTATATSASVPTSAGGFPPYLVGSGPGIDFDAGT
FT                   PAGSRRAQPAADNVTAVAAAQVSARHQARRRRRAAAKERGNADEFVDMDSGPAIPPSGE
FT                   RDAWASNSGVGGLGFAGTASNETVAAPAGLTTLADDEFQCGPRMPVLPGAWDLGTWDRG
FT                   D"
     atgacgagcg cactgatatg gatggcctct ccgccggagg tgcattcggc cttgttgagt        60
     agtgggccgg ggccggggcc ggtactggcc gccgccacag ggtggtcgtc actgggccgt       120
     gaatacgccg cggttgctga ggaactcggg gcattgctgg ctgcggtgca agccggggtg       180
     tggcaggggc ccagcgccga atcatttgct gccgcgtgcc tgccgtatct gtcttggttg       240
     acgcaggcca gcgccgactg cgccgcggcg gctgcccggc tggaggcggt gaccgccgcc       300
     tacgccgcgg ctttggtggc catgcccacc ctggccgagt tggcggctaa ccacgcgacc       360
     cacggggcca tggtggcgac caatttcttc gggatcaaca ccataccgat cgcggtcaac       420
     gaggccgact acgtgcggat gtggcttcag gcggccacca cgatggccac ctatcaagcg       480
     gtcgcggact cggcggtgcg ctcgatcccg gacagcgtgc ctccgccgcg aattctgaaa       540
     tccaatgccc aatcccaaca ctcgagctcg aataattccg ggggcgcgga cccggtggac       600
     gacttcattg cagagatctt gaagatcatc accggcggtc gcgtgatctg ggaccccgaa       660
     gccggcactg tcaacggcct cccctatgac gcttatacca accccggcac actcatgtgg       720
     tggattgcca gaagtctgga acttcttcaa gactttcaag agttcgccaa gctgctgttc       780
     accaatccgg tgaaggcttt tcagttcctt gtcgacctca tcctgttcga ctggcctaca       840
     cacatgctgc agctggctac ctggctggcc gagaacccgc agttgctggt ggctgcgctc       900
     accccagcca tctccggact gggagcggta tcggggttgg ccgggttgac cggcctagtc       960
     cctcagcccc ccgtcgtgcc cgcgccggca cccgatgcgg tcgtgcccac cgtgttgcca      1020
     ctcgccggga cggccacgcc gactaccgcg ccggccagcg ccccggccgc cggagcggcg      1080
     cccgggcccc cggccggtac cgccactgcc acatcggcgt cggtgccaac gagcgccggc      1140
     ggctttcccc cttacctcgt gggcagcggt ccaggcatcg acttcgacgc ggggacgccc      1200
     gccggttcca ggagagcgca gcccgccgcg gataacgtca cggccgtggc ggcagcgcag      1260
     gtgtcggccc gtcatcaggc acgtcggcgc cgacgagcgg cggcgaagga acgtggcaac      1320
     gccgacgagt tcgtcgatat ggactccggc ccggcgattc cgccgtcggg cgagcgggac      1380
     gcttgggcgt ccaattcggg cgtgggcggg ctggggtttg ccggcaccgc aagcaacgag      1440
     acggtggcag cgccggccgg attgaccacg ctggccgacg atgagttcca gtgtggccca      1500
     cggatgccgg tgctgccggg cgcttgggac ttgggaactt gggaccgcgg ggactga         1557
//

If you have problems or comments...

PBIL Back to PBIL home page