(data stored in ACNUC1104 zone)

EMBL: CP000717.PE461

CP000717.PE461       Location/Qualifiers
FT   CDS_pept        complement(548544..548990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10461"
FT                   /old_locus_tag="TBFG_00452"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0455c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10461"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04804"
FT                   /protein_id="ABR04804.1"
FT                   /translation="MSRLSSILRAGAAFLVLGIAAATFPQSAAADSTEDFPIPRRMIAT
FT                   TCDAEQYLAAVRDTSPVYYQRYMIDFNNHANLQQATINKAHWFFSLSPAERRDYSEHFY
FT                   NGDPLTFAWVNHMKIFFNNKGVVAKGTEVCNGYPAGDMSVWNWA"
     atgtctcggc tgagttccat cctgcgtgcc ggcgcggcat ttctggttct cggcatcgcc        60
     gctgcgacat ttccacaaag cgcggcagcc gactccacgg aagactttcc aatacctcgc       120
     cggatgatcg caaccacctg cgacgccgaa caatatctgg cggcggtgcg ggataccagt       180
     ccggtgtact accagcggta catgatcgac ttcaacaacc atgcaaacct tcagcaagcg       240
     acgatcaaca aggcgcactg gttcttctcg ctgtcaccgg cggagcgccg agactactcc       300
     gaacactttt acaatggcga tccgctgacg tttgcctggg tcaatcacat gaaaatcttc       360
     ttcaacaaca agggcgtcgt cgctaaaggg accgaggtgt gcaatggata cccagccggc       420
     gacatgtcgg tgtggaactg ggcctaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page