(data stored in ACNUC1104 zone)

EMBL: CP000717.PE467

CP000717.PE467       Location/Qualifiers
FT   CDS_pept        554879..555157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10467"
FT                   /old_locus_tag="TBFG_00457"
FT                   /product="conserved hydrophobic protein"
FT                   /note="Mapped to H37Rv Rv0460"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10467"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04810"
FT                   /protein_id="ABR04810.1"
FT                   /translation="MIPLPRSWQLTSAMLVGNAIGLLAGVACSVLVHARIRPDIVIAMV
FT                   VGIPSAIGLLVILFSGRRWVTMLGAFILALAPGWFGVLVAIQVASSG"
     gtgatccccc ttccgcggtc atggcagctg accagcgcga tgctggttgg taatgcgatc        60
     ggactgctag cgggggtggc gtgcagcgtg ctggtgcatg cccggatccg tccggacatc       120
     gtcatcgcaa tggtagtcgg gattcccagc gcgatcgggc tgctggtcat cctgttctcc       180
     ggacgtcgat gggtgacgat gctgggcgcg ttcatcctgg cgttggcgcc gggttggttt       240
     ggtgtgctgg ttgcgatcca ggtggcgtcc agtggctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page