(data stored in ACNUC1104 zone)

EMBL: CP000717.PE47

CP000717.PE47        Location/Qualifiers
FT   CDS_pept        complement(51929..52798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10047"
FT                   /old_locus_tag="TBFG_00047"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0048c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04390"
FT                   /protein_id="ABR04390.1"
FT                   /translation="MAKWLGAPLARGVSTATRAKDSDRQDACRILDDALRDGELSMEEH
FT                   RERVSAATKAVTLGDLQRLVADLQVESAPAQMPALKSRAKRTELGLLAAAFVASVLLGV
FT                   GIGWGVYGNTRSPLDFTSDPGAKPDGIAPVVLTPPRQLHSLGGLTGLLEQTRKRFGDTM
FT                   GYRLVIYPEYASLDRVDPADDRRVLAYTYRGGWGDATSSAKSIADVSVVDLSKFDAKTA
FT                   VGIMRGAPETLGLKQSDVKSMYLIVEPVKDPTTPAALSLSLYVSSDYGGGYLVFAGDGT
FT                   IKHVSYPS"
     gtggcgaagt ggctgggcgc accccttgcg cgcggagtat cgacggcaac ccgcgccaaa        60
     gacagcgacc ggcaggacgc ctgccggatt ctcgacgacg ccctgcgtga cggcgagctc       120
     tcgatggagg aacaccggga gcgcgtcagc gcagctacca aggctgtgac cctaggtgac       180
     ctgcagcgtc tggtggccga cctgcaggtc gagagcgcac ccgcacaaat gcccgcgctc       240
     aaatcgcggg cgaaacgcac cgagttgggc ttgctggccg ctgcgtttgt cgcatcggtg       300
     ctgctgggcg tcggcatcgg ctggggcgtg tacggcaaca cccgctctcc gctggacttc       360
     acctcggatc ccggagcaaa gcccgacggg atcgcccccg tggtgctgac cccgcccagg       420
     cagctgcatt ccctcggcgg gctcaccggc ctgctggagc agacccgcaa gcggttcggc       480
     gacaccatgg gctaccggct ggtgatctac ccggagtatg cgtcgctcga tcgcgtcgac       540
     ccggcggacg accgccgagt cctggcgtat acctaccgcg gcggctgggg cgatgcgacc       600
     agttccgcca agagcattgc cgacgtgtcc gtggttgacc tgagcaaatt cgatgcgaag       660
     accgctgtgg gcatcatgcg cggcgccccg gaaaccctcg gcctcaaaca atccgacgtc       720
     aaaagcatgt acctgatcgt cgaaccggtc aaggacccca ccacgccggc tgcgttgtcg       780
     ttgtcgttgt atgtctctag cgactacggc ggtggatacc tcgttttcgc aggtgacggc       840
     accatcaagc acgtcagcta cccgtcttga                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page