(data stored in ACNUC1104 zone)

EMBL: CP000717.PE471

CP000717.PE471       Location/Qualifiers
FT   CDS_pept        complement(557482..558054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10471"
FT                   /old_locus_tag="TBFG_00461"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0464c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04814"
FT                   /protein_id="ABR04814.1"
FT                   /translation="MTGQNGQVARISPGKFRQLGPVNWLVAKLAARAVGAPQMHLFTTL
FT                   GYRQYLFWTFAIYTGRLLHGRLPGVDTELVILRVAHLRSCEYELQHHRRMARRRGLDAN
FT                   TQATIFAWPDVPDGDGPRKVLSARQQALLQATDELIKDRTITAGTWERLATHLDPRLLI
FT                   EFCLLATQYDAIAATITALAIPPDNPQ"
     atgaccggtc agaacggcca agtcgcgcgt atctccccgg ggaagttccg ccagctgggg        60
     ccggtcaact ggctggtggc caagctggcc gcacgtgcgg ttggggcacc gcagatgcac       120
     ctgttcacca cgctgggcta ccgccagtac ttgttctgga cctttgccat ctacaccggc       180
     cgactactgc acgggcggct gcccggcgtc gataccgagt tggtgatcct tcgggtcgca       240
     cacctacgat cttgcgaata cgaacttcag catcatcgcc gaatggcgcg ccgtcggggc       300
     ctagacgcca acacccaggc cacgatattc gcctggcccg acgttccaga tggagacgga       360
     ccgcgaaaag tgctcagcgc ccgccaacag gcgctgctac aggctaccga tgaattgatc       420
     aaggatcgca cgatcaccgc gggcacctgg gagcggctgg caactcacct cgatccgcgc       480
     ctgttgatcg aattctgttt actcgcaacc caatacgacg cgatcgccgc aacgatcacc       540
     gccctggcca tcccgccgga caacccacag tag                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page