(data stored in ACNUC1104 zone)

EMBL: CP000717.PE472

CP000717.PE472       Location/Qualifiers
FT   CDS_pept        complement(558051..559475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10472"
FT                   /old_locus_tag="TBFG_00462"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0465c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04815"
FT                   /protein_id="ABR04815.1"
FT                   /translation="MSKTYVGSRVRQLRNERGFSQAALAQMLEISPSYLNQIEHDVRPL
FT                   TVAVLLRITEVFGVDATFFASQDDTRLVAELREVTLDRDLDIAIDPHEVAEMVSAHPGL
FT                   ACAVVNLHRRYRITTAQLAAATEERFSDGSGRGSITMPHEEVRDYFYQRQNYLHALDTA
FT                   AEDLTAQMRMHHGDLARELTRRLTEVHGVRINKRIDLGDTVLHRYDPATNTLEISSHLS
FT                   PGQQVFKMAAELAYLEFGDLIDAMVTDGKFTSAESRTLARLGLANYFAAATVLPYRQFH
FT                   DVAENFRYDVERLSAFYSVSYETIAHRLSTLQRPSMRGVPFTFVRVDRAGNMSKRQSAT
FT                   GFHFSSSGGTCPLWNVYETFANPGKILVQIAQMPDGRNYLWVARTVELRAARYGQPGKT
FT                   FAIGLGCELRHAHRLVYSEGLDLSGDPNTAATPIGAGCRVCERDNCPQRAFPALGRALD
FT                   LDEHRSTVSPYLVKQL"
     gtgtccaaga cctacgtcgg ctcgcgggtc cgccaactgc gtaacgagcg cgggttcagc        60
     caggccgcgc tggcccagat gctggagatc tcgccgagct atctgaacca gatcgaacac       120
     gacgtccggc cgctgaccgt ggccgtgctg ctgcgcatca ccgaagtgtt cggggtggac       180
     gcgacgttct ttgcctccca ggacgacacc cggctggttg ccgaactcag ggaggtgacc       240
     ctggaccgcg atctagacat cgccatcgac ccgcatgaag tggccgaaat ggtcagcgct       300
     catcccgggc tggcctgcgc ggtggtcaac ctgcatcggc gctaccggat caccaccgcg       360
     cagctggccg ccgcgaccga ggagcggttc tccgacggca gtggccgagg gtcgatcacc       420
     atgccgcacg aagaggtgcg cgactacttc taccaacgcc agaactatct acatgcgctg       480
     gacaccgcgg ccgaagacct cacggcccag atgcggatgc accacggcga cctggcccgc       540
     gaattgaccc gccggctcac cgaggtgcac ggagtacgca tcaacaagcg catcgacctc       600
     ggtgacaccg tgctgcaccg ctacgacccc gcgaccaaca cgctggagat cagcagtcac       660
     ctctccccgg gccagcaggt gttcaagatg gccgccgagt tggcctatct cgagttcggc       720
     gacctcatcg acgccatggt caccgacggc aagttcacca gcgccgagtc gcggacgttg       780
     gcccggctgg gcctggctaa ttacttcgcc gcggccaccg tgctgcccta ccgccagttc       840
     cacgacgtcg ccgagaattt ccgctacgac gtcgagcggc tgtcggcgtt ctactcggtg       900
     agctacgaga ccatcgccca ccggctgtcg acactacaac ggccttcgat gcgcggggtc       960
     ccgttcacct tcgtccgggt ggaccgagcg ggaaacatgt caaaacgtca gtcggccacc      1020
     ggctttcact tctcctccag cggcggcacc tgcccgctgt ggaacgtcta cgaaacgttt      1080
     gccaacccgg ggaagatctt ggtgcaaatc gcccagatgc ccgacggccg caactacctg      1140
     tgggtggccc gcaccgttga gctccgggcc gcccggtatg gtcagcccgg taagaccttc      1200
     gcgatcgggc tgggctgcga acttcgccac gcgcaccggc tcgtctactc ggaaggactc      1260
     gacttgtcgg gtgacccgaa tactgcggcc acacctatcg gcgccggttg ccgcgtctgc      1320
     gaacgcgaca actgtccgca acgcgccttc cccgccttgg ggcgggcact ggatctcgac      1380
     gaacaccgca gcacggtgtc cccgtatctg gtgaaacaac tatga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page