(data stored in ACNUC1104 zone)

EMBL: CP000717.PE48

CP000717.PE48        Location/Qualifiers
FT   CDS_pept        52932..53345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10048"
FT                   /old_locus_tag="TBFG_00048"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0049"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10048"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04391"
FT                   /protein_id="ABR04391.1"
FT                   /translation="MDYTLRRRSLLAEVYSGRTGVSEVCDANPYLLRAAKFHGKPSRVI
FT                   CPICRKEQLTLVSWVFGEHLGAVSGSARTAEELILLATRFSEFAVHVVEVCRTCSWNHL
FT                   VKSYVLGAARPARPPRGSGGTRTARNGARTASE"
     gtggactaca cgctacggcg acgctccctg ctggccgagg tgtattcggg acgcaccggt        60
     gtgtcggagg tgtgcgacgc caacccctac ctgctgcgcg ccgcaaagtt tcatgggaag       120
     cccagccggg tcatctgccc gatctgccgc aaggagcagc tcacactggt gtcgtgggtg       180
     ttcggcgagc acctcggtgc ggtatcaggg tccgcgcgca ccgccgaaga actgatcctg       240
     ctggcgaccc ggttctccga gttcgcggtc cacgtggtgg aggtatgtcg aacctgcagt       300
     tggaatcatc tggtcaagtc atacgtcctg ggcgccgcac gtccggcacg cccccctagg       360
     gggtctggcg ggacgcggac ggcgcgcaac ggggcccgca cggccagtga atag             414
//

If you have problems or comments...

PBIL Back to PBIL home page