(data stored in ACNUC1104 zone)

EMBL: CP000717.PE482

CP000717.PE482       Location/Qualifiers
FT   CDS_pept        568190..568612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10482"
FT                   /old_locus_tag="TBFG_00472"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0474"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10482"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04825"
FT                   /protein_id="ABR04825.1"
FT                   /translation="MSSEEKLAAKVSTKASDVASDIGSFIRSQRETAHVSMRQLAERSG
FT                   VSNPYLSQVERGLRKPSADVLSQIAKALRVSAEVLYVRAGILEPSETSQVRDAIITDTA
FT                   ITERQKQILLDIYASFTHQNEATREECPSDPTPTDD"
     atgtcgtcgg aggagaagct ggccgccaag gtgtccacca aggcctccga tgtggcttcc        60
     gacatcggca gcttcatcag gtcgcaacgt gagacggcgc acgtctcgat gcggcagctc       120
     gccgagcggt ccggcgtcag caatccgtac ctgagccagg ttgagcgcgg attgcgtaag       180
     ccgtccgccg acgtgttgag ccagatcgca aaggcgctgc gggtctcggc cgaagtcctt       240
     tatgtgcgcg ccgggattct cgagcccagc gagaccagtc aggtgcgtga cgccatcatc       300
     accgatacgg cgatcaccga gcgtcagaag cagattctgc tcgatatcta cgcgtcattt       360
     acccaccaga acgaagccac ccgggaggag tgtccgagcg atccgacacc gaccgatgac       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page