(data stored in ACNUC1104 zone)

EMBL: CP000717.PE484

CP000717.PE484       Location/Qualifiers
FT   CDS_pept        569677..569940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10484"
FT                   /old_locus_tag="TBFG_00474"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0476"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10484"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04827"
FT                   /protein_id="ABR04827.1"
FT                   /translation="MLVLLVAVLVTAVYAFVHAALQRPDAYTAADKLTKPVWLVILGAA
FT                   VALASILYPVLGVLGMAMSACASGVYLVDVRPKLLEIQGKSR"
     atgctggtat tgctggtcgc cgtcttggtg acagcggtgt acgcgtttgt gcatgctgcg        60
     ttgcagcggc ccgatgccta taccgccgcc gacaagctga ccaagccggt gtggttggtg       120
     atcctgggcg cggccgtggc gttggcctcc atcctgtatc ccgttttggg tgtgctcggg       180
     atggcgatgt ccgcctgtgc gtccggcgtg tatctggtcg acgtgcggcc caagcttctc       240
     gagattcagg gcaagtcgcg ctaa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page