(data stored in ACNUC1104 zone)

EMBL: CP000717.PE485

CP000717.PE485       Location/Qualifiers
FT   CDS_pept        569945..570391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10485"
FT                   /old_locus_tag="TBFG_00475"
FT                   /product="conserved secreted protein"
FT                   /note="Mapped to H37Rv Rv0477"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10485"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04828"
FT                   /protein_id="ABR04828.1"
FT                   /translation="MKALVAVSAVAVVALLGVSSAQADPEADPGAGEANYGGPPSSPRL
FT                   VDHTEWAQWGSLPSLRVYPSQVGRTASRRLGMAAADAAWAEVLALSPEADTAGMRAQFI
FT                   CHWQYAEIRQPGKPSWNLEPWRPVVDDSEMLASGCNPGSPEESF"
     atgaaagccc tggtggccgt gtcggcggtg gccgtcgtcg cactgctcgg tgtatcttcc        60
     gcccaagctg atcccgaggc ggatcccggc gcaggtgagg ccaactatgg tggcccccca       120
     agttccccac gtcttgtcga tcacaccgaa tgggcgcagt ggggaagtct gcccagcctc       180
     cgggtctacc cgtcccaagt tgggcgtaca gcctcccgcc gcctcgggat ggccgctgcc       240
     gacgcggcct gggccgaggt tctcgcgctg tcaccggagg ccgacactgc cggcatgcgc       300
     gcgcagttca tctgccactg gcagtacgcc gaaatcagac aacccggcaa acccagctgg       360
     aacctcgagc cgtggcggcc ggtcgtcgac gactcggaga tgttggcttc cggctgcaat       420
     ccgggcagcc ctgaagagtc gttttag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page