(data stored in ACNUC1104 zone)

EMBL: CP000717.PE496

CP000717.PE496       Location/Qualifiers
FT   CDS_pept        580833..581438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10496"
FT                   /old_locus_tag="TBFG_00486"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0488"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10496"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04839"
FT                   /protein_id="ABR04839.1"
FT                   /translation="MMTLKVAIGPQNAFVLRQGIRREYVLVIVALCGIADGALIAAGVG
FT                   GFAALIHAHPNMTLVARFGGAAFLIGYALLAARNAWRPSGLVPSESGPAALIGVVQMCL
FT                   VVTFLNPHVYLDTVVLIGALANEESDLRWFFGAGAWAASVVWFAVLGFSAGRLQPFFAT
FT                   PAAWRILDALVAVTMIGVAVVVLVTSPSVPTANVALII"
     atgatgacgc tcaaggtcgc gatcggcccg caaaacgcat ttgtcctgcg ccaaggaatt        60
     aggcgagaat acgtgctggt cattgtggcg ctgtgcggga tcgctgatgg ggcactgatt       120
     gccgcgggcg ttggcggctt cgctgcgctg attcacgctc atcccaatat gactttggtt       180
     gcccgatttg gcggcgcagc gttcttgatt ggctacgcgc tattggccgc gcggaacgcg       240
     tggcgcccga gcgggctggt gccgtcggaa tcggggccgg ctgcgctgat cggcgtggtg       300
     caaatgtgcc tggtggtgac ctttctcaac ccacacgtct atctggacac tgtggtgttg       360
     atcggtgccc tcgccaatga ggaatcagat ctgcggtggt ttttcggagc cggtgcctgg       420
     gccgccagcg tcgtatggtt cgccgtgttg ggatttagcg cgggccggct acagccattc       480
     ttcgcaactc cagctgcttg gcgcattctt gatgcgctgg ttgccgtgac gatgattggg       540
     gtcgccgtcg ttgtgctcgt cacgtcacca agtgtgccga cggccaatgt cgcactgatc       600
     atttga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page