(data stored in ACNUC1104 zone)

EMBL: CP000717.PE498

CP000717.PE498       Location/Qualifiers
FT   CDS_pept        582518..583750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10498"
FT                   /old_locus_tag="TBFG_00488"
FT                   /product="two component system sensor histidine kinase
FT                   senX3"
FT                   /note="Mapped to H37Rv Rv0490"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04841"
FT                   /protein_id="ABR04841.1"
FT                   /translation="MTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSG
FT                   ITVSQMLQCIVTLMPLGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQALGG
FT                   EDVEFDLSPRKRSATGRSGLSVHGHARLLSEEDRRFAVVFVHDQSDYARMEAARRDFVA
FT                   NVSHELKTPVGAMALLAEALLASADDSETVRRFAEKVLIEANRLGDMVAELIELSRLQG
FT                   AERLPNMTDVDVDTIVSEAISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLV
FT                   SNAIAYSPRGSLVSISRRRRGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATG
FT                   GSGLGLAIVKHVAANHDGTIRVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRS
FT                   NRSQREEELSR"
     gtgactgtgt tctcggcgct gttgctggcc ggggttttgt ccgcgctggc actggccgtc        60
     ggtggtgctg ttggaatgcg gctgacgtcg cgggtcgtcg aacagcgcca acgggtggcc       120
     acggagtggt cgggaatcac ggtttcgcag atgttgcaat gcattgtcac gctgatgccg       180
     ctgggcgccg cggtggtgga cacccatcgc gacgttgtct acctcaacga acgggccaaa       240
     gagctaggtc tggtgcgcga ccgccagctc gatgatcagg cctggcgggc cgcccggcag       300
     gcgctgggtg gtgaagacgt cgagttcgac ctgtcgccgc gcaagcggtc ggccacgggt       360
     cgatccgggc tatcagtgca tgggcatgcc cggttgctga gcgaggaaga ccgccggttc       420
     gccgtggtgt tcgtgcacga ccagtcggat tatgcgcgga tggaggcggc taggcgtgac       480
     ttcgtggcca acgtcagtca cgagctcaag acgcccgtcg gtgccatggc tctactcgcc       540
     gaggcgctgc tggcgtcggc cgacgactcc gaaaccgttc ggcggttcgc cgagaaggtg       600
     ctcattgagg ccaaccggct cggtgacatg gtcgccgagt tgatcgagct atcccggcta       660
     cagggcgccg agcggctacc caatatgacc gacgtcgacg tcgatacgat tgtgtcggaa       720
     gcgatttcac gccataaggt ggcggccgac aacgccgaca tcgaagtccg caccgacgcg       780
     cccagcaatc tgcgggtgct gggcgaccaa actctgctgg ttaccgcact ggcaaacctg       840
     gtttccaatg cgattgccta ttcgccgcgc gggtcgctgg tgtcgatcag ccgtcgccgt       900
     cgcggtgcca acatcgagat cgccgtcacc gaccggggca tcggcatcgc gccggaagac       960
     caggagcggg tcttcgaacg gttcttccgg ggggacaagg cgcgctcgcg tgccaccgga      1020
     ggcagcggac tcgggttggc catcgtcaaa cacgtcgcgg ctaatcacga cggcaccatc      1080
     cgcgtgtgga gcaaaccggg aaccgggtca acgttcacct tggctcttcc ggcgttgatc      1140
     gaggcctatc acgacgacga gcgacccgag caggcgcgag agcccgaact gcggtcaaac      1200
     aggtcacaac gagaggaaga gctgagccga tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page