(data stored in ACNUC1104 zone)

EMBL: CP000717.PE499

CP000717.PE499       Location/Qualifiers
FT   CDS_pept        583954..584637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10499"
FT                   /old_locus_tag="TBFG_00489"
FT                   /product="two component system sensor transduction protein
FT                   regX3"
FT                   /note="Mapped to H37Rv Rv0491"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10499"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04842"
FT                   /protein_id="ABR04842.1"
FT                   /translation="MTSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAG
FT                   ADIVLLDLMLPGMSGTDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYS
FT                   ARELIARIRAVLRRGGDDDSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLE
FT                   YLMRNSGRVLTRGQLIDRVWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLG
FT                   YKLEG"
     atgaccagtg tgttgattgt ggaggacgag gagtcgctgg ccgatccgct ggcgtttctg        60
     ctgcgcaagg agggctttga ggccacggtg gtgaccgatg gtccggcagc tctcgccgag       120
     ttcgaccggg ccggcgccga catcgtcctg ctcgatctga tgctgcctgg gatgtcgggt       180
     accgatgtat gcaagcagtt gcgcgctcgg tccagcgttc cggtgatcat ggtgaccgcc       240
     cgggatagcg agatcgacaa ggtggtcggc ctggagctgg gcgctgacga ctacgtgacc       300
     aagccctatt cggcacgcga gttgatcgca cgcatccgcg cggtgctgcg ccgtggcggc       360
     gacgacgact cggagatgag cgatggcgtg ctggagtccg ggccggttcg catggatgtg       420
     gagcgccatg tcgtctcggt gaacggtgac accatcacgc tgccgctcaa ggagttcgac       480
     ctgctggaat acctgatgcg caacagcggg cgggtgttga ctcgcggaca actgatcgac       540
     cgggtctggg gtgcggacta cgtgggcgac accaagacgc tcgacgtcca tgtcaagcgg       600
     ctgcgctcca agatcgaagc cgacccggct aacccggttc acttggtgac ggtgcgcggg       660
     ctgggctaca aactcgaggg ctag                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page