(data stored in ACNUC1104 zone)

EMBL: CP000717.PE5

CP000717.PE5         Location/Qualifiers
FT   CDS_pept        5224..7368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10005"
FT                   /old_locus_tag="TBFG_00005"
FT                   /product="DNA gyrase subunit B gyrB"
FT                   /note="Mapped to H37Rv Rv0005"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04348"
FT                   /protein_id="ABR04348.1"
FT                   /translation="MGKNEARRSALAPDHGTVVCDPLRRLNRMHATPEESIRIVAAQKK
FT                   KAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTV
FT                   NVVLLEDGGVEVADDGRGIPVATHASGILTVDVVMTQLHAGGKFDSDAYAISGGLHGVG
FT                   VSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETT
FT                   EYDFETVARRLQEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTA
FT                   PHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSESV
FT                   HTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISV
FT                   KVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIA
FT                   ARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAI
FT                   LPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDG
FT                   QHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLK
FT                   AGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGED
FT                   VDARRSFITRNAKDVRFLDV"
     atgggtaaaa acgaggccag aagatcggcc ctggcgcccg atcacggtac agtggtgtgc        60
     gaccccctgc ggcgactcaa ccgcatgcac gcaacccctg aggagagtat tcggatcgtg       120
     gctgcccaga aaaagaaggc ccaagacgaa tacggcgctg cgtctatcac cattctcgaa       180
     gggctggagg ccgtccgcaa acgtcccggc atgtacattg gctcgaccgg tgagcgcggt       240
     ttacaccatc tcatttggga ggtggtcgac aacgcggtcg acgaggcgat ggccggttat       300
     gcaaccacag tgaacgtagt gctgcttgag gatggcggtg tcgaggtcgc cgacgacggc       360
     cgcggcattc cggtcgccac ccacgcctcc ggcatactga ccgtcgacgt ggtgatgaca       420
     caactacatg ccggcggcaa gttcgactcg gacgcgtatg cgatatctgg tggtctgcac       480
     ggcgtcggcg tgtcggtggt taacgcgcta tccacccggc tcgaagtcga gatcaagcgc       540
     gacgggtacg agtggtctca ggtttatgag aagtcggaac ccctgggcct caagcaaggg       600
     gcgccgacca agaagacggg gtcaacggtg cggttctggg ccgaccccgc tgttttcgaa       660
     accacggaat acgacttcga aaccgtcgcc cgccggctgc aagagatggc gttcctcaac       720
     aaggggctga ccatcaacct gaccgacgag agggtgaccc aagacgaggt cgtcgacgaa       780
     gtggtcagcg acgtcgccga ggcgccgaag tcggcaagtg aacgcgcagc cgaatccact       840
     gcaccgcaca aagttaagag ccgcaccttt cactatccgg gtggcctggt ggacttcgtg       900
     aaacacatca accgcaccaa gaacgcgatt catagcagca tcgtggactt ttccggcaag       960
     ggcaccgggc acgaggtgga gatcgcgatg caatggaacg ccgggtattc ggagtcggtg      1020
     cacaccttcg ccaacaccat caacacccac gagggcggca cccacgaaga gggcttccgc      1080
     agcgcgctga cgtcggtggt gaacaagtac gccaaggacc gcaagctact gaaggacaag      1140
     gaccccaacc tcaccggtga cgatatccgg gaaggcctgg ccgctgtgat ctcggtgaag      1200
     gtcagcgaac cgcagttcga gggccagacc aagaccaagt tgggcaacac cgaggtcaaa      1260
     tcgtttgtgc agaaggtctg taacgaacag ctgacccact ggtttgaagc caaccccacc      1320
     gacgcgaaag tcgttgtgaa caaggctgtg tcctcggcgc aagcccgtat cgcggcacgt      1380
     aaggcacgag agttggtgcg gcgtaagagc gccaccgaca tcggtggatt gcccggcaag      1440
     ctggccgatt gccgttccac ggatccgcgc aagtccgaac tgtatgtcgt agaaggtgac      1500
     tcggccggcg gttctgcaaa aagcggtcgc gattcgatgt tccaggcgat acttccgctg      1560
     cgcggcaaga tcatcaatgt ggagaaagcg cgcatcgacc gggtgctaaa gaacaccgaa      1620
     gttcaggcga tcatcacggc gctgggcacc gggatccacg acgagttcga tatcggcaag      1680
     ctgcgctacc acaagatcgt gctgatggcc gacgccgatg ttgacggcca acatatttcc      1740
     acgctgttgt tgacgttgtt gttccggttc atgcggccgc tcatcgagaa cgggcatgtg      1800
     tttttggcac aaccgccgct gtacaaactc aagtggcagc gcagtgaccc ggaattcgca      1860
     tactccgacc gcgagcgcga cggtctgctg gaggcggggc tgaaggccgg gaagaagatc      1920
     aacaaggaag acggcattca gcggtacaag ggtctaggtg aaatggacgc taaggagttg      1980
     tgggagacca ccatggatcc ctcggttcgt gtgttgcgtc aagtgacgct ggacgacgcc      2040
     gccgccgccg acgagttgtt ctccatcctg atgggcgagg acgtcgacgc gcggcgcagt      2100
     tttatcaccc gcaacgccaa ggatgttcgg ttcctggatg tctaa                      2145
//

If you have problems or comments...

PBIL Back to PBIL home page