(data stored in ACNUC1104 zone)

EMBL: CP000717.PE503

CP000717.PE503       Location/Qualifiers
FT   CDS_pept        587840..588568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10503"
FT                   /old_locus_tag="TBFG_00493"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0494"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04846"
FT                   /protein_id="ABR04846.1"
FT                   /translation="MVEPMNQSSVFQPPDRQRVDERIATTIADAILDGVFPPGSTLPPE
FT                   RDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSGSVVRDPEGLTHPAVVEALVRKLGPD
FT                   FLVELLEIRAALGPLIGRLAAARSTPEDAEALCAALEVVQQADTAAARQAADLAYFRVL
FT                   IHSTRNRALGLLYRWVEHAFGGREHALTGAYDDADPVLTDLRAINGAVLAGDPAAAAAT
FT                   VEAYLNASALRMVKSYRDRA"
     ttggttgagc caatgaacca gtcaagtgtc tttcagccgc cggatcggca gcgggtggat        60
     gagcggatcg cgacgacgat cgccgacgcc atcctcgacg gcgtcttccc gccgggctcg       120
     accctgccgc ccgagcgaga cctggcagag cggctcggtg tcaaccgcac ctcgctacgc       180
     cagggtctgg cgcgactgca acagatgggc ctgatcgagg tgcggcacgg cagcggcagt       240
     gtggtccgtg accccgaggg gctcacccat cccgcggtgg tcgaggcgct ggtgcgcaaa       300
     ctgggccccg acttcctcgt cgagttgctg gagatccgcg cggcgttagg cccgttgatt       360
     ggccgcctgg cggccgcccg gagcacgccc gaggatgccg aggcgttgtg tgcggcgctg       420
     gaagtggtgc aacaggcgga cacggccgcg gcgcggcagg cagccgatct tgcctacttc       480
     cgggtgctca tccacagcac tcgcaaccgc gcattggggt tgctctaccg ctgggtggag       540
     cacgccttcg gcggccgcga gcatgcgctc accggggcct acgacgacgc ggacccagtg       600
     ttgaccgacc tgcgggcgat caacggggcg gtgctggccg gtgacccggc ggccgctgcc       660
     gcgaccgtcg aggcgtatct gaacgccagt gcgctgcgca tggtcaagtc ctaccgcgac       720
     cgcgcttag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page