(data stored in ACNUC1104 zone)

EMBL: CP000717.PE504

CP000717.PE504       Location/Qualifiers
FT   CDS_pept        complement(588569..589459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10504"
FT                   /old_locus_tag="TBFG_00494"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0495c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10504"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04847"
FT                   /protein_id="ABR04847.1"
FT                   /translation="MWRPAQGARWHVPAVLGYGGIPRRASWSNVESVANSRRRPVHPGQ
FT                   EVELDFAREWVEFYDPDNPEHLIAADLTWLLSRWACVFGTPACQGTVAGRPNDGCCSHG
FT                   AFLSDDDDRTRLADAVHKLTDDDWQFRAKGLRRKGYLELDEHDGQPQHRTRKHKGACIF
FT                   LNRPGFAGGAGCALHSKALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTTLT
FT                   EYDRRGWGSGGADLHWYCTGDPAAHVGTKQVWQSLADELTELLGEKAYGELAAMCKRRS
FT                   QLGLIAVHPATRAAQ"
     gtgtggcgac ccgcgcaagg cgcccggtgg catgtgccgg ccgtgctggg ctatggcgga        60
     atcccgcggc gggcttcgtg gtctaacgtt gaatccgtgg caaattcgcg acggagaccg       120
     gtgcacccgg ggcaagaagt cgagttggac ttcgcccgtg agtgggtgga gttctacgac       180
     ccggacaatc ccgagcacct gatcgcggcc gaccttacct ggttgctgtc gcgctgggcg       240
     tgtgtattcg gcacacccgc ctgccagggc accgtcgcgg gccggccaaa cgacggctgt       300
     tgttcgcacg gtgcgttcct gtccgacgac gacgaccgca cccggttggc cgacgcggtg       360
     cacaagctga ccgacgacga ctggcagttc cgggcaaagg gcctgcgccg caagggctac       420
     ctggaactcg acgagcacga cggccaaccc cagcaccgca cccgcaaaca caagggcgcg       480
     tgtatcttct tgaaccggcc cgggttcgcc ggtggcgccg gctgcgcgct gcacagcaaa       540
     gccctcaagc tgggcgtgcc gccgttgacg atgaaacccg atgtctgctg gcagttgccg       600
     atccggcgca gccaggaatg ggtgacccgc cccgacggca ccgaaatcct caagaccacc       660
     ctcaccgaat atgaccgccg cggttggggc tcgggtggtg ctgacctgca ctggtattgc       720
     accggcgatc cggccgccca tgtcggaacc aagcaggtgt ggcagagcct tgccgacgaa       780
     ctcaccgaat tactcgggga gaaggcctat ggggaactcg cagcaatgtg caagcgccgc       840
     agtcaattag ggctcatcgc cgtacatccg gcgacgcgtg cggcccagta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page