(data stored in ACNUC1104 zone)

EMBL: CP000717.PE508

CP000717.PE508       Location/Qualifiers
FT   CDS_pept        592328..593203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10508"
FT                   /old_locus_tag="TBFG_00498"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0499"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10508"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04851"
FT                   /protein_id="ABR04851.1"
FT                   /translation="MNALFTTAMALRPLDSDPGNPACRVFEGELNEHWTIGPKVHGGAM
FT                   VALCANAARTAYGAAGQQPMRQPVAVSASFLWAPDPGTMRLVTSIRKRGRRISVADVEL
FT                   TQGGRTAVHAVVTLGEPEHFLPGVDGSGGASGTAPLLSANPVVELMAPEPPEGVVPIGP
FT                   GHQLAGLVHLGEGCDVRPVLSTLRSATDGRPPVIQLWARPRGVAPDALFALLCGDLSAP
FT                   VTFAVDRTGWAPTVALTAYLRALPADGWLRVLCTCVEIGQDWFDEDHIVVDRLGRIVVQ
FT                   TRQLAMVPAQ"
     atgaacgcgt tgttcaccac ggcgatggcg ctgcgcccgc ttgactccga tcccggcaat        60
     ccggcgtgcc gggtttttga aggcgagctg aacgagcact ggaccatcgg gcccaaggtg       120
     cacggcggtg cgatggtggc gctgtgtgcc aatgccgccc gcaccgctta cggcgcggcc       180
     ggacagcagc ccatgcggca accggtcgca gtgtcggcga gctttctgtg ggcgccggat       240
     ccggggacga tgcggttggt gacgtcgatc cgcaagcgtg gtcgccggat tagcgtggcc       300
     gatgtcgagc tcacccaggg tggccgcaca gcggtgcacg ccgtggtcac cctaggtgag       360
     ccggagcatt ttctccccgg cgttgatggg agcggcgggg ccagtggaac cgcgccgctg       420
     ctgtcggcga atccggtggt ggagctgatg gcaccggaac cgcccgaggg agtcgtgccg       480
     atcggtcccg gccatcagct ggccgggctg gtgcacttag gcgaaggctg cgatgtccgg       540
     ccggtgttgt cgacgttgcg gtccgcgacc gatgggcggc caccggtgat tcagctgtgg       600
     gcgcgtccac gcggcgttgc tccggacgcg ctgttcgctc tgttgtgcgg ggacttgtcg       660
     gccccggtga ccttcgcggt ggaccgcacc ggctgggcgc ctacagttgc gctcaccgcc       720
     tatcttcggg ccctgcccgc cgacggctgg ctgcgagtgc tctgcacctg cgtcgaaatc       780
     gggcaggact ggtttgacga ggaccacatc gtcgtcgacc ggttgggccg catcgtggtg       840
     cagacgcgcc aactggcgat ggtgcctgcc cagtag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page