(data stored in ACNUC1104 zone)

EMBL: CP000717.PE511

CP000717.PE511       Location/Qualifiers
FT   CDS_pept        594536..594721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10511"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0500B"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10511"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04854"
FT                   /protein_id="ABR04854.1"
FT                   /translation="MLGRCRFGVPCDRPGRVSGSDSRIDGGVMGSVIKKRRKRMSKKKH
FT                   RKLLRRTRVQRRKLGK"
     atgctcgggc gctgccggtt tggtgttccg tgcgaccgcc cgggtagagt gtccgggtca        60
     gatagccgta tagatggcgg ggtcatgggt tcagtaatca agaagcggcg caagcgcatg       120
     tccaagaaaa agcatcgcaa gctgctgcgt cgcacccggg tgcagcgcag gaaactgggc       180
     aaatag                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page