(data stored in ACNUC1104 zone)

EMBL: CP000717.PE518

CP000717.PE518       Location/Qualifiers
FT   CDS_pept        600344..603250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10518"
FT                   /old_locus_tag="TBFG_00507"
FT                   /product="transmembrane transport protein mmpL2"
FT                   /note="Mapped to H37Rv Rv0507"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10518"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04861"
FT                   /protein_id="ABR04861.1"
FT                   /translation="MSERHAALTSLPPILPRLIRRFAVVIVLLWLGFTAFVNLAVPQLE
FT                   VVGKAHSVSMSPSDAASIQAIKRVGQVFGEFDSDNAVTIVLEGDQPLGGDAHRFYSDLM
FT                   RKLSADTRHVAHIQDFWGDPLTAAGSQSADDRAAYVVVYLVGNNETEAYDSVHAVRHMV
FT                   DTTPPPHGVKAYVTGPAALNADQAEAGDKSIAKVTAITSMVIAAMLLVIYRSVITAVLV
FT                   LIMVGIDLGAIRGFIALLADHNIFSLSTFATNLLVLMAIAASTDYAIFMLGRYHESRYA
FT                   GEDRETAFYTMFHGTAHVILGSGLTIAGAMYCLSFARLPYFETLGAPIAIGMLVAVLAA
FT                   LTLGPAVLTVGSFFKLFDPKRRMNTRRWRRVGTAIVRWPGPVLAATCLVASIGLLALPS
FT                   YRTTYDLRKFMPASMPSNVGDAAAGRHFSRARLNPEVLLIETDHDMRNPVDMLVLDKVA
FT                   KNIYHSPGIEQVKAITRPLGTTIKHTSIPFIISMQGVNSSEQMEFMKDRIDDILVQVAA
FT                   MNTSIETMHRMYALMGEVIDNTVDMDHLTHDMSDITATLRDHLADFEDFFRPIRSYFYW
FT                   EKHCFDVPLCWSIRSIFDMFDSVDQLSEKLEYLVKDMDILITLLPQMRAQMPPMISAMT
FT                   TMRDMMLIWHGTLGAFYKQQERNNKDPGAMGRVFDAAQIDDSFYLPQSAFENPDFKRGL
FT                   KMFLSPDGKAARFVIALEGDPATPEGISRVEPIKREAREAIKGTPLQGAAIYLGGTAAT
FT                   FKDIREGARYDLLIAGVAAISLILIIMMIITRSVVAAVVIVGTVVLSMGASFGLSVLVW
FT                   QDILGIELYWMVLAMSVILLLAVGSDYNLLLISRLKEEIGAGLNTGIIRAMAGTGGVVT
FT                   AAGMVFAVTMSLFVFSDLRIIGQIGTTIGLGLLFDTLVVRSFMTPSIAALLGRWFWWPL
FT                   RVRPRPASQMLRPFAPRRLVRALLLPSGQHPSATGAHE"
     atgagcgaaa gacacgccgc actgacgtca ctgccgccca ttctgccgcg gctgatccgc        60
     cggtttgcgg tggtgatcgt cctgctctgg ctgggcttca ccgcctttgt caatctcgcc       120
     gtaccgcaac tggaagtggt cggaaaagca cactcggtat cgatgagccc cagcgacgcc       180
     gcatcgattc aggcgatcaa gcgcgttggt caggtgttcg gtgagtttga ttccgataac       240
     gcggtaacga tcgtgctgga aggcgaccag ccactcggtg gggacgcgca ccggttctat       300
     agcgatctga tgcggaagct ttccgccgat acccgccatg tcgcgcacat ccaggacttc       360
     tggggggatc cgctgacagc ggcgggatcc caaagtgcgg atgatcgggc cgcctacgtc       420
     gtggtgtacc tcgtcggtaa caacgaaacc gaagcgtatg actcggtcca cgcggtgcgg       480
     cacatggtgg acaccacacc gccaccgcac ggggtgaagg cctatgtcac cggtccggca       540
     gcactcaatg ccgaccaggc cgaggccgga gacaaaagta tcgctaaggt caccgcgatc       600
     acgagcatgg tgatcgcggc aatgttgcta gtgatctatc gctccgtaat taccgcggtt       660
     ctcgtcttga tcatggtcgg catcgacctc ggcgcaatcc gcggattcat cgccttgctc       720
     gccgaccaca acattttcag cctttcaaca tttgcgacca acctgctcgt tctcatggcg       780
     attgcggcga gcacggacta cgcgatattc atgctcggcc gttaccacga atcgcgctac       840
     gccggcgagg atcgggaaac ggccttctac acgatgtttc acgggaccgc ccacgtgatc       900
     ttgggttcgg gtttgaccat tgccggcgcc atgtattgcc tcagctttgc ccggcttccg       960
     tattttgaaa cgctcggcgc gcccattgct atcggcatgc tggtcgcggt cttggcggcg      1020
     ctcacgctcg gcccggccgt actgaccgtg ggcagcttct tcaagctgtt cgatcccaag      1080
     cggcggatga acactcggcg gtggcgccgg gtgggaacgg caattgtgcg ttggccgggg      1140
     ccggtgctcg cggcgacatg cttggtcgcc tccattggct tgctggcctt gcccagttac      1200
     cggacaacgt atgatctgcg caagttcatg cccgccagca tgccgtccaa tgtgggggat      1260
     gcggcggctg gtcgacactt ttcacgggct cggctgaacc ctgaggtgct gttgatcgag      1320
     actgaccacg atatgcgtaa tccggtggac atgctggtgt tggacaaggt agccaaaaat      1380
     atctaccaca gtcccggtat tgaacaagtg aaagcgataa cccggccctt gggaacaacc      1440
     atcaagcaca cttcgatacc gttcatcatc agcatgcagg gcgtgaatag tagcgagcaa      1500
     atggaattca tgaaggaccg aattgatgac atactggtgc aggtggccgc gatgaatacc      1560
     tccatcgaga cgatgcatcg catgtatgca ctcatgggcg aggtcattga caacaccgtc      1620
     gacatggatc atctcacgca tgatatgtcg gacataacgg ctacgctaag agatcatctc      1680
     gcggatttcg aggatttctt ccggcctatt cgcagctact tctactggga aaaacattgt      1740
     ttcgacgttc cgctctgctg gtcgataaga tcgatattcg atatgtttga cagtgtggac      1800
     cagctgagcg aaaagctcga gtacctggtc aaggatatgg atattctgat tacactgttg      1860
     ccgcagatgc gcgcgcagat gccgccgatg atatctgcga tgacgacgat gcgggacatg      1920
     atgcttatct ggcatggcac gcttggcgcg ttctataagc aacaggagag gaataacaag      1980
     gaccccggcg cgatgggccg ggtttttgac gccgcccaga tcgatgattc gttctatctg      2040
     ccgcagtcgg cttttgagaa tccggatttc aagcgggggc tgaagatgtt tttgtctccg      2100
     gacggcaagg cagcccgctt tgtcattgct ctggagggag atcccgcaac gcccgagggc      2160
     atctctcggg tcgagccgat caagcgggag gctagagagg ccataaaggg aactccattg      2220
     cagggcgctg cgatctatct gggtggcacc gcggcgacgt tcaaggatat tcgagagggc      2280
     gccagatacg atctgctgat cgccggagtg gcggcgataa gcttgatttt gatcatcatg      2340
     atgatcatca cccgaagtgt ggtagccgca gtggttatcg tgggtaccgt cgtgctttcc      2400
     atgggcgcct ctttcgggct ttccgtattg gtctggcagg acattctggg tatcgagttg      2460
     tactggatgg tgttggcgat gtcggtgatc ctgctcctgg cggtgggatc cgactacaat      2520
     ctgctgctga tttcccggtt gaaagaggaa attggggccg gattgaacac cggaattatc      2580
     cgtgccatgg ctggtaccgg gggagtggtg acggctgccg gcatggtgtt cgccgttacc      2640
     atgtcgttgt ttgtgttcag cgatttgcga attattggtc agatcggtac caccatcggc      2700
     ctgggcttgc tgttcgacac cctcgtcgtg cgctcgttca tgacaccgtc cattgctgcg      2760
     ctgctgggac gctggttctg gtggccgcta cgggtgcgcc cgcgcccggc cagtcagatg      2820
     cttcggccgt tcgcgccgcg ccgattggtt cgcgccttgt tgctgccgtc cggccagcac      2880
     ccgtcagcga ctggcgccca tgagtag                                          2907
//

If you have problems or comments...

PBIL Back to PBIL home page