(data stored in ACNUC1104 zone)

EMBL: CP000717.PE52

CP000717.PE52        Location/Qualifiers
FT   CDS_pept        58296..58586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10052"
FT                   /old_locus_tag="TBFG_00052"
FT                   /product="30S ribosomal protein S6 rpsF"
FT                   /note="Mapped to H37Rv Rv0053"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04395"
FT                   /protein_id="ABR04395.1"
FT                   /translation="MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGK
FT                   RRLAYEIAKHAEGIYVVIDVKAAPATVSELDRQLSLNESVLRTKVMRTDKH"
     atgcgtccat acgaaatcat ggtcatcctc gacccgaccc tcgacgaacg caccgtagcc        60
     ccgtccttgg agacgttcct caacgtcgtc cgtaaggacg gcggaaaagt cgaaaaggtg       120
     gacatctggg gcaagcgtcg gctggcgtac gagatcgcca agcatgccga aggcatctac       180
     gtggtgatcg acgtgaaagc cgccccggcg acggtgtccg aactcgaccg ccagctcagc       240
     ctcaacgagt cggtgttgcg caccaaggta atgcgcaccg acaagcacta a                291
//

If you have problems or comments...

PBIL Back to PBIL home page