(data stored in ACNUC1104 zone)

EMBL: CP000717.PE530

CP000717.PE530       Location/Qualifiers
FT   CDS_pept        complement(614316..615218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10530"
FT                   /old_locus_tag="TBFG_00519"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0519c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04873"
FT                   /protein_id="ABR04873.1"
FT                   /translation="MLRRGCAGNTDRRGIMTPMADLTRRALLRWGAGAGAGAAGVWAFG
FT                   ALVDPLEPQAAPAPFEPPTAGSSLPTRISGSFISAARGGIKTNWVISMPPGQSGQLRPV
FT                   IALHGKDGNAGMMLDLGVEQGLARLVKEGKPAFAVVGVDGGNTYWHRRSSGGDSGAMVL
FT                   DELLPMLTSMGMDTSRVGFLGWSMGGYGALLLGARLGPARTAGICAISPALFTSFTGST
FT                   PGAFDSYDDYVQHSVLGLPALNSIPLRVDCGTSDRFYFATRQFVNQLHQPPAGSFSPGG
FT                   HDASYWREQLPGELAWMAS"
     gtgctacggc gtggctgtgc gggcaacacc gatcggcgcg gcatcatgac gcccatggca        60
     gacctgaccc gccgtgccct gctccgttgg ggtgccggcg ccggcgcggg agccgccggc       120
     gtgtgggcct tcggcgccct ggtggaccca cttgagccgc aggcggcccc ggcgccgttc       180
     gagcccccga cggcgggcag cagcttgccg accaggatct ccggctcgtt catctcggcg       240
     gctcgcggag gcatcaagac caactgggtg atctccatgc cgcccggcca gagcgggcag       300
     ctgcggccag tgatcgcact gcatggcaag gacggcaacg ccggcatgat gctggatctc       360
     ggcgtcgagc aggggttggc ccgcctggtc aaggagggca agccagcgtt cgcggtggtc       420
     ggcgtcgacg gcggcaacac ctactggcac cgtcgctctt ccggcgggga ctcgggtgcg       480
     atggtgctcg acgagctgct gccgatgctg acctcgatgg gtatggacac ctcccgggtg       540
     ggattcctgg ggtggtcgat ggggggatac ggcgcgctgc tcctgggtgc ccggttgggt       600
     ccggccagaa ccgcggggat ctgtgccatc agcccggcat tgttcacgtc gttcaccggc       660
     agcacacccg gggcgttcga cagctacgac gactatgtgc aacacagcgt gttgggcctg       720
     cccgcgctga actcaatccc gctacgggtg gattgcggca ccagcgaccg cttctacttc       780
     gccactcgcc aattcgtcaa ccaactgcac caaccgcctg ccggcagctt ctcgcccgga       840
     ggacacgacg cgtcgtactg gcgcgaacag ttgcccggcg aactggcttg gatggcgtcc       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page