(data stored in ACNUC1104 zone)

EMBL: CP000717.PE534

CP000717.PE534       Location/Qualifiers
FT   CDS_pept        complement(617470..617865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10534"
FT                   /old_locus_tag="TBFG_00523"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0523c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10534"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04877"
FT                   /protein_id="ABR04877.1"
FT                   /translation="MQLPQWLARFNRYVTNPIQRLWAGWLPAFAILEHVGRRSGKPYRT
FT                   PLNVFSADVDGRAGVAILLTYGPNRDWLKNITAAGGGRMRRYGKTFGVANPRRLTKAEA
FT                   APYVSSRWRPVFARLPFDEAVLLTKAD"
     atgcaactac cgcagtggct ggctcggttc aatcgatatg tcaccaaccc cattcagcgg        60
     ctatgggccg gctggctccc ggcgttcgcg attcttgagc acgtgggccg ccgctcgggc       120
     aagccgtacc gtaccccgtt gaacgtgttc agcgcggacg tcgacggccg ggcgggcgtg       180
     gcgattttgc tcacctacgg tccgaaccgc gactggctga agaacatcac cgcggccggc       240
     ggtggccgga tgcgccgcta cggcaaaacc tttggtgtcg ccaacccgcg gcggctcacc       300
     aaggccgagg cggcgccgta tgtcagcagc cgatggcggc cggtctttgc cagactgccg       360
     ttcgacgagg ccgtactgct caccaaggcc gattaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page