(data stored in ACNUC1104 zone)

EMBL: CP000717.PE536

CP000717.PE536       Location/Qualifiers
FT   CDS_pept        619367..619975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10536"
FT                   /old_locus_tag="TBFG_00525"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0525"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10536"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04879"
FT                   /protein_id="ABR04879.1"
FT                   /translation="MPEETQVHVVRHGEVHNPTGILYGRLPGFHLSATGAAQAAAVADA
FT                   LADRDIVAVIASPLQRAQETAAPIAARHDLAVETDPDLIESANFFEGRRVGPGDGAWRD
FT                   PRVWWQLRNPFTPSWGEPYVDIAARMTTAVDKARVRGAGHEVVCVSHQLPVWTLRLYLT
FT                   GKRLWHDPRRRDCALASVTSLIYDGDRLVDVVYSQPAAL"
     atgcccgagg aaacccaagt ccacgtggtg cgccacggtg aggtgcacaa ccctaccggc        60
     atcctgtacg ggcggctgcc cggattccac ctgtccgcaa ccggcgcggc gcaggccgcc       120
     gccgtcgccg acgcgctggc cgaccgcgac atcgtcgcgg taatcgcatc gcccttgcag       180
     cgtgcccagg agaccgccgc gcccatcgcc gcccggcatg accttgcggt ggagacagac       240
     ccggatctga tcgaatcggc caacttcttc gagggccgcc gcgtcggccc cggtgacggg       300
     gcatggcgcg acccgcgggt gtggtggcag ctgcgtaacc cgttcacccc gtcgtggggt       360
     gagccttacg tggatatcgc tgcccgaatg acgaccgcgg tggacaaggc acgtgtccgc       420
     ggcgccggcc atgaggtggt gtgcgtcagc catcagctgc cggtgtggac gctgcggctg       480
     tatctgaccg gtaagcgcct ctggcacgat ccgcgccgtc gggactgcgc actggcctcg       540
     gtgacgtcgt tgatctacga cggcgaccgc ctggttgacg tggtgtattc gcagccggcg       600
     gcgctttga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page