(data stored in ACNUC1104 zone)

EMBL: CP000717.PE539

CP000717.PE539       Location/Qualifiers
FT   CDS_pept        621449..623038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10539"
FT                   /old_locus_tag="TBFG_00528"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0528"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10539"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04882"
FT                   /protein_id="ABR04882.1"
FT                   /translation="MWRSLTSMGTALVLLFLLALAAIPGALLPQRGLNAAKVDDYLAAH
FT                   PLIGPWLDELQAFDVFSSFWFTAIYVLLFVSLVGCLAPRTIEHARSLRATPVAAPRNLA
FT                   RLPKHAHARLAGEPAALAATITGRLRGWRSITRQQGDSVEVSAEKGYLREFGNLVFHFA
FT                   LLGLLVAVAVGKLFGYEGNVIVIADGGPGFCSASPAAFDSFRAGNTVDGTSLHPICVRV
FT                   NNFQAHYLPSGQATSFAADIDYQADPATADLIANSWRPYRLQVNHPLRVGGDRVYLQGH
FT                   GYAPTFTVTFPDGQTRTSTVQWRPDNPQTLLSAGVVRIDPPAGSYPNPDERRKHQIAIQ
FT                   GLLAPTEQLDGTLLSSRFPALNAPAVAIDIYRGDTGLDSGRPQSLFTLDHRLIEQGRLV
FT                   KEKRVNLRAGQQVRIDQGPAAGTVVRFDGAVPFVNLQVSHDPGQSWVLVFAITMMAGLL
FT                   VSLLVRRRRVWARITPTTAGTVNVELGGLTRTDNSGWGAEFERLTGRLLAGFEARSPDM
FT                   AEAAAGTGRDVD"
     atgtggcggt cgttgacgtc gatgggcacc gcgctggtgc tgctgttttt gctcgcgctg        60
     gctgccatac ccggggccct gctgccgcag cgtggcctca acgccgccaa ggtggacgac       120
     tacctggccg cgcacccact catcggtccg tggctggacg agctgcaggc cttcgacgtg       180
     ttctccagct tctggttcac cgccatctac gtgctgctgt tcgtgtccct cgtcggctgt       240
     ctggccccgc ggacgatcga gcacgcccgc agcctgcggg ctacaccggt cgccgccccg       300
     cgcaacctgg cccggctgcc caagcacgcc cacgcccggc tggccggcga gcccgccgcc       360
     ctggccgcca ccatcacggg ccggctgcgc ggctggcgca gcatcacccg gcaacaaggc       420
     gacagcgtgg aagtctccgc cgagaagggc tacctgcgcg agttcggcaa cctggtgttc       480
     cacttcgcgc tgctgggtct gctggtggcg gtggccgtcg gcaagctgtt cggctacgag       540
     ggcaacgtga tcgtgatagc cgacggcgga cccggttttt gttcggcgtc gccggccgcg       600
     ttcgactcgt ttcgcgccgg caacaccgtc gacggcacgt cgttgcaccc gatctgtgtg       660
     cgggtcaaca acttccaagc gcactacctg ccgtccgggc aggccacctc gttcgccgcc       720
     gacatcgact atcaggccga cccggccact gctgacctga tcgccaacag ctggcggccc       780
     taccggctgc aggtcaatca cccgctgcgg gtcggcggcg accgggtgta cctgcagggc       840
     cacggctatg cgcccacctt caccgtgacg ttcccggacg ggcagacccg cacgtcgacc       900
     gtgcagtggc gacccgacaa cccgcagacc ctgctgtcgg cgggcgtcgt gcgcatcgac       960
     ccgccggccg gcagctaccc caaccccgac gagcgtcgca aacaccagat cgccatccag      1020
     ggcctgctgg ctcccaccga gcagctcgac ggcaccctgc tgtcgtcgcg tttccccgcg      1080
     ctcaatgccc cggcggtggc catcgacatc taccgcggcg acaccggcct ggacagcggg      1140
     cggccccagt cgttgttcac cctggaccac cggctgatcg agcagggccg gctggtcaag      1200
     gaaaagcggg tcaacctgcg cgccggtcag caagtccgca tcgaccaagg cccggcggcc      1260
     ggcacggtgg tccggttcga cggcgcggtg ccgttcgtca acctgcaggt ctcccacgac      1320
     cccggccagt cctgggtgct ggtcttcgca atcacgatga tggcgggact gctggtgtcg      1380
     ctgctggtgc gcaggcgccg ggtgtgggcg cggatcacgc cgacgaccgc gggtacggta      1440
     aacgtcgagc tgggcggcct gacgcgcacc gacaactccg ggtggggcgc cgagttcgag      1500
     cggctgaccg ggcggttgct ggcgggtttt gaggcgcggt ccccggacat ggccgaagcg      1560
     gccgcaggga ccggaaggga cgtcgattga                                       1590
//

If you have problems or comments...

PBIL Back to PBIL home page