(data stored in ACNUC1104 zone)

EMBL: CP000717.PE540

CP000717.PE540       Location/Qualifiers
FT   CDS_pept        623035..624009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10540"
FT                   /old_locus_tag="TBFG_00529"
FT                   /product="cytochrome C-type biogenesis protein ccsA"
FT                   /note="Mapped to H37Rv Rv0529"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04883"
FT                   /protein_id="ABR04883.1"
FT                   /translation="MNTLHVNVGLARYSDWAFTSAVVALVVALLLLAFEFAQVRGRGLA
FT                   PLAVPAGSVATDSATPGIVADQRHRPFDERVGRGGLAVAYLGIGLLLACVVLRGLATQR
FT                   VPWGNMYEFINLTCLSGLIAGAVVLRRARYRPLWVFLLVPVLILLTVSGRWLYANAAPV
FT                   MPALQSYWLPIHVSVVSLGSGVFLVAGVASILFLVRTSRLGEPTGEGALAGMVRRLPDA
FT                   QTLDGIAYRTTIFAFPVFGFGVIFGAIWAEEAWGRYWGWDPKETVSFVAWVVYAAYLHA
FT                   RSTAGWRDRKAAWINVAGFVAMVFNLFFVNLVTVGLHSYAGVG"
     ttgaacacgc tgcacgtcaa cgtcggcctg gcccgctact ccgactgggc gttcacctcg        60
     gccgtggtgg cgctggtggt cgcgctgctg ctgctggcgt tcgagttcgc ccaggttcgc       120
     ggtcgcggac tcgcgccgct ggccgtgccg gccggatcgg tggccaccga tagcgctacc       180
     cctgggatcg tggcggacca acggcaccgg ccgttcgacg aacgcgtcgg gcggggcggg       240
     ctggccgtcg cctatctggg catcgggcta ctgctggcgt gcgtcgtgct gcgcggcctg       300
     gccacccagc gggtgccgtg gggcaacatg tacgagttca tcaacctgac ctgcttgtcc       360
     gggctcatcg ccggcgcggt cgtgctgcgc cgtgcgcgat accggccgct gtgggtcttc       420
     ctgctggtcc cggtgctgat cctgctcacc gtgtccggac gctggctcta cgccaatgcc       480
     gccccggtga tgccggcact gcagtcctac tggctgccca ttcatgtgtc ggtggtcagc       540
     ctcggttctg gggtattcct ggtcgccggt gtcgccagca tcctgttcct tgtgcgcaca       600
     tcgcggctgg gtgagccaac cggtgaaggc gcgctggcgg gtatggtgcg gcggctcccc       660
     gatgcccaaa ccctggacgg aatcgcctac cggaccacga tcttcgcctt ccccgttttc       720
     ggcttcgggg tgatattcgg tgccatctgg gccgaggaag cctggggccg ctactggggc       780
     tgggacccca aggagacggt gtccttcgtc gcgtgggtgg tgtacgcggc gtacctgcac       840
     gcgcggtcaa cggcgggttg gcgggaccgc aaggccgcct ggatcaatgt cgccggcttc       900
     gtggccatgg tcttcaatct gttcttcgtt aacctggtga ccgtcggcct gcactcgtat       960
     gcgggcgtgg gctga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page