(data stored in ACNUC1104 zone)

EMBL: CP000717.PE542

CP000717.PE542       Location/Qualifiers
FT   CDS_pept        625473..625790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10542"
FT                   /old_locus_tag="TBFG_00532"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0531"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10542"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04885"
FT                   /protein_id="ABR04885.1"
FT                   /translation="MSEAPNDKTTRGVVDILVYATARLLLVVAVSAAIFGVARLIGLTE
FT                   FPVVVATLFGLIIAMPLGIWVFSPLRRRATAALAVAGERRRAERERLRARLRGESLPEE
FT                   Q"
     gtgtcagaag cgcctaacga caagaccact cggggtgttg tcgacatact ggtctatgcg        60
     acggcgcggc tgctgctggt ggtggcggtc agcgcagcga ttttcggggt cgcgcgactg       120
     atcgggttga ccgaattccc cgttgtcgtg gccacgctgt tcgggctgat catcgcgatg       180
     ccgttgggca tttgggtgtt cagcccgctg cggcggcgcg ccacggccgc gctcgcggtg       240
     gccggtgagc gtcggcgcgc cgagcgggaa cggctgcggg cccggctgcg tggcgagtcg       300
     ctacccgaag aacagtga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page