(data stored in ACNUC1104 zone)

EMBL: CP000717.PE543

CP000717.PE543       Location/Qualifiers
FT   CDS_pept        625937..627805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10543"
FT                   /old_locus_tag="TBFG_00533"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0532"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04886"
FT                   /protein_id="ABR04886.1"
FT                   /translation="MSNLLVTPELVAAAAADLAGIGSAIGAANAAAGAPTMALLAAGAD
FT                   EVSAAVAAVFSSYAQQYQALSAAAAAFHDQFVRALAAGAGAYAGAEAANVEQQLLNAIN
FT                   APTLALLGRPLIGNGADGAAGTGQAGGAGGLLYGNGGNGGSGAAGQAGGAGGAAGLIGH
FT                   GGTGGVGGTGAAGGAGGTGGWLFGNGGAGGTGGAVTGVSTTGGPGGHGGDAGLYGFGGA
FT                   GGAGGFGQSGAAGGAGGAGGWLYGDGGDGGAGGNGGNESGTGVSGVGGVGGAGGAGGLL
FT                   FGNGGDGGVGGDGGDGSSTQDSGGDGGAGGAGGAGGWLLGNGGAGGAGGAASIKVATGG
FT                   LGGDGGDAGLFGFGGDGGWGGRGVDARFGAAGGAAGAGGAGGWLYGDGGAGGVGGVGGA
FT                   VFSLSSGDGGAGGAGGGGGWLFGNGGDGGAGGGGGGRFGSGSGAGGDGAVGGAGGAGAW
FT                   FGNGGAGGVGGGGGRGTTAIGGDGGAGGAGGAGGWLYGDGGAGGAGGGGGRGGTGNDGG
FT                   DGGDGGRGGDAQLLGNGGDGGAGGAGGPAGLALPPGPARPAGAAVPAVRCSAAPARPAR
FT                   TADPWLAPIFARSTLRHSHHLGGIAQTGAVADQQGQIAGLGRAGRQ"
     atgtctaatt tgctggtaac cccggagctg gtggcggctg cggcggcgga tttggcgggt        60
     attgggtcgg ctatcggtgc ggccaatgcg gcggccgggg ccccgacgat ggcgctgttg       120
     gccgccggtg ccgatgaggt gtcggcggcg gtggcggccg tgttttcctc ctacgcccag       180
     caatatcagg cgctgagcgc tgcggcggcg gcgtttcacg accagttcgt gcgggcgttg       240
     gccgcgggtg cgggtgcgta tgcgggcgcc gaggccgcca acgtggagca gcagttgctg       300
     aacgcgatca atgcgcccac cctcgcgttg ttggggcggc cgctgatcgg caacggcgcc       360
     gacggggcgg ccgggaccgg tcaggccggc ggggcaggcg ggctgttgta cggcaacggc       420
     ggtaacggcg ggtcgggtgc ggccgggcag gccggcgggg ccggcggcgc cgccgggctg       480
     atcggccacg gcgggaccgg cggggtcggg ggtaccggtg cggccggcgg ggccggcggg       540
     accggcgggt ggctgttcgg caacggcggg gccggcggga ccggcggggc cgtcaccggg       600
     gtcagcacca ccggcgggcc gggcggtcac ggcggtgacg ccggcctgta cgggtttggc       660
     ggggccggtg gcgcgggtgg gttcggccag agcggggcgg ccggcggggc cggtggggcc       720
     ggtgggtggt tgtacggcga cggcggcgac ggcggcgcag gcggcaacgg cggtaacgag       780
     tccggcaccg gcgtcagtgg cgttgggggt gtgggtgggg ccggtggtgc tggtgggttg       840
     ttgttcggta acggcggcga cggcggcgtc ggcggcgacg gcggcgacgg cagcagcacc       900
     caggattccg gtggtgatgg gggtgcgggt ggggccggtg gtgctggtgg gtggttgctt       960
     ggtaatgggg gggccggcgg ggccggcggg gccgcctcaa tcaaggttgc cactggtggg      1020
     ctgggtggtg atggtggcga tgccgggctg ttcgggtttg gtggggacgg cggctggggc      1080
     ggacgcggag tggatgctcg attcggtgcg gctgggggtg ccgctggggc cggcggtgcg      1140
     ggcgggtggt tgtacggcga tggcggcgcc ggcggcgtcg gcggtgtcgg cggtgctgtc      1200
     ttcagccttt cctccggtga cggcggggcc ggcggggccg gtggcggtgg tgggtggttg      1260
     ttcggtaacg gcggcgacgg cggcgccggt ggcggcggcg gtggccgctt cggcagcggc      1320
     agcggtgccg gtggtgatgg ggctgtcggt ggggccggtg gtgcgggcgc gtggttcggc      1380
     aacggtggcg ccggcggcgt cggcggcggc ggtggccgcg gcaccaccgc catcggtggc      1440
     gacgggggtg ccggtggggc cggtggtgcg ggtgggtggt tgtacggcga cggcggcgcc      1500
     ggcggtgccg gcggcggtgg tggccgcggc ggcaccggca acgatggtgg cgacggcggg      1560
     gacggcggcc gcggcggtga tgcccagctg cttggcaacg gcggtgacgg cggggccggc      1620
     ggggccggcg ggcccgccgg gttggcgctt cccccggggc cggcgcggcc ggcgggggcg      1680
     gcggtgccgg cggttcgctg ttcggcagcc ccggcacgac cggcccgcac ggctgatccc      1740
     tggctagcgc cgatcttcgc gcgctcaacc cttcggcatt cgcaccacct gggcggcata      1800
     gctcagaccg gcgccgtagc cgatcaacag ggccagatcg ccgggcttgg ccgcgccggt      1860
     cgtcagtaa                                                              1869
//

If you have problems or comments...

PBIL Back to PBIL home page