(data stored in ACNUC1104 zone)

EMBL: CP000717.PE56

CP000717.PE56        Location/Qualifiers
FT   CDS_pept        60000..60521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10056"
FT                   /old_locus_tag="TBFG_00056"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0057"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04399"
FT                   /protein_id="ABR04399.1"
FT                   /translation="MPVVTAVGRRRGFAMPWVSTARSGAVMLANYSAGVCGRVSSPGLN
FT                   VRKMCLKANTPGAVTWLDTPKRFLSTQTASRCMAVNSSDVVTGRIDPQVLHTPLNTDVD
FT                   GYAHAMHSSINSGPLEYLPATFSVFPALGDVGDLGGGVGAATYALDRLSNMRSGACVGG
FT                   GESPWRSLMT"
     atgccggtgg tgaccgcggt cggccgccgc cggggtttcg ccatgccctg ggtgtccacc        60
     gcacggtccg gtgcggtgat gctggcgaac tattcggccg gcgtttgcgg gcgggtgtct       120
     tcaccgggcc ttaacgtcag gaaaatgtgt ctgaaagcca acacgcccgg cgcggtaacc       180
     tggctcgaca cgccgaagag attcttgtcc acacaaacgg cgtcgcgttg tatggccgtt       240
     aacagcagtg atgtcgtaac gggccgtatt gatccacagg ttctccacac cccgctcaac       300
     acagacgtcg acggatatgc acatgcgatg cacagctcca taaacagtgg ccccttggag       360
     tacttgccag caacgtttag cgtcttcccg gcgctaggcg atgtgggtga cttgggcggt       420
     ggtgtcggtg cggcgactta cgctctggat aggttgtcga atatgcgttc gggtgcttgt       480
     gtcggaggag gtgagagccc atggcggtcg ttgatgacct ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page