(data stored in ACNUC1104 zone)

EMBL: CP000717.PE562

CP000717.PE562       Location/Qualifiers
FT   CDS_pept        646108..647721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10562"
FT                   /old_locus_tag="TBFG_00553"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0552"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04905"
FT                   /protein_id="ABR04905.1"
FT                   /translation="MEPMADADLVMTGTVLTVDDARPTAEAIAVADGRVIAVGDRSEVA
FT                   GLVGANTRVIDLGAGCVMPGFVEAHGHPLLEAVVLSDRFVDIRPVTMRDADDVVAAIRG
FT                   EVARRGPAGAYLVGWDPLLQSGLGEPTLTWLDSLAPNGPLVIIHNSGHKAYFNSHAAWL
FT                   NGLTRDTADPKGAKYGRDGNGELDGTAEEIGAILPLLAGVADPSNFGAMLRAECARLNR
FT                   AGLTTCSEMAFDPGYRPMVEAVRAELTVRLCTYEISNARMCTDATPGQGDDMLRQVGIK
FT                   IWVDGSPWVGNIDLTFPYLDTPATRAIGVPPGSRGCANYTREQLAEIVGAYFPRGWQIA
FT                   CHVHGDGGVDTILDVYEEALRRNPRDDHRLRLEHVGAIRPDQLRRAAELGVTCSIFVDQ
FT                   IHYWGDVIVDDLFGAQRGSRWMPAGSAVAAGMRISLHNDPPVTPEEPLRNISVAATRVA
FT                   PSGRVLAPEERLTVEQAIRAQTIDAAWQLFAEDAIGSLQVGKYADMVVLSADPRTVPPE
FT                   QIADLAVRATFLAGRQVYRR"
     ttggagccca tggccgatgc agacctcgtc atgaccggaa ccgtgctcac cgtcgacgat        60
     gcgcggccaa cggccgaggc gatcgcggtc gccgacggcc gggtcattgc cgtcggtgac       120
     cggtccgagg ttgccggcct ggttggcgcc aacacccggg tcatcgatct gggtgccggg       180
     tgcgtcatgc caggatttgt tgaggcacac ggccatccgc tactggaggc ggtcgtgctg       240
     tcggaccggt tcgtcgatat ccgtccggtg acgatgcggg acgcggacga cgtcgttgcc       300
     gcgatccgcg gcgaggttgc acggcgcggc ccggccggcg cctatctggt cggctgggat       360
     ccgctgctgc agtccggtct tggcgagccg acgctgacct ggctcgacag cctcgcgccg       420
     aacgggccgc tggtgatcat ccacaactcc ggacacaagg cttacttcaa ctcgcacgcc       480
     gcctggctca atgggctcac ccgagacacc gcggatccca agggcgcgaa gtatggccgc       540
     gacggcaatg gcgaactcga cggcaccgcc gaggaaatcg gcgcgattct tccgcttttg       600
     gccggtgtag ccgaccccag caacttcggt gccatgctgc gcgccgagtg tgctcggctc       660
     aaccgtgccg gcctgaccac atgctcggag atggcttttg acccagggta tcggccgatg       720
     gtcgaggcgg tgcgcgccga actgacggtc cggctgtgca cctacgagat ctccaatgcg       780
     cggatgtgca ccgatgcgac gcctgggcaa ggtgacgaca tgctgcgcca ggtgggcatc       840
     aagatctggg tggacggctc gccgtgggtc ggcaatatcg atctgacctt tccctacctg       900
     gacacccccg ccacccgtgc catcggtgta ccgcccggtt cccgcgggtg cgccaattac       960
     acccgtgaac agttggccga aatcgtcggg gcctactttc cgcggggctg gcagatcgcc      1020
     tgtcacgtgc acggcgacgg cggtgtggac accatcctcg acgtctacga agaggcactg      1080
     cgccgcaatc ctcgagacga tcaccggctg cggctcgaac acgtcggggc catccggccc      1140
     gaccaactgc ggcgcgccgc cgaactcggt gtcacctgca gcatcttcgt cgaccagatc      1200
     cattactggg gcgatgtgat cgtcgatgac ctgttcgggg cacagcgcgg gtcccggtgg      1260
     atgccggctg gatccgcggt ggccgccggc atgcgtatct cgctgcacaa cgacccgccc      1320
     gtcacaccgg aggagccact gcgcaacatc agcgtggccg caacccgggt ggcgcccagt      1380
     ggccgggtgc tggcaccgga ggagcgcctg acggtcgagc aggcgattcg cgcgcagacc      1440
     atcgatgccg cctggcaact gttcgctgag gacgcgatcg gctcgcttca ggtcggcaag      1500
     tacgcggata tggtggtgct gtcggcggat ccccggacgg tgccgccaga gcagatcgcc      1560
     gacctggcgg tgcgggcgac gtttctggcc ggtcgccagg tttatcggcg gtga            1614
//

If you have problems or comments...

PBIL Back to PBIL home page