(data stored in ACNUC1104 zone)

EMBL: CP000717.PE566

CP000717.PE566       Location/Qualifiers
FT   CDS_pept        651187..651702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10566"
FT                   /old_locus_tag="TBFG_00557"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0556"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10566"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04909"
FT                   /protein_id="ABR04909.1"
FT                   /translation="MISPKPLLHILIHGRSDELPDTRGRIVLRWLRIAVLIVTGLVTLQ
FT                   SVLLVAGAWRNDIAIQRNMGVAQAEVLSAGPRRSTIEFVTPDRITYRPQLGVLYPSELS
FT                   TGMRIYVEYNKRDPNLVRVQHRNAGLAIIPAGSIAVVAWLIAAAALVVLAVLDKRLERR
FT                   ENSASATG"
     gtgatatcac cgaaacccct gctgcacatc ctgattcatg ggcgcagtga tgaactgccc        60
     gatactcgag gcaggatcgt gctgcgctgg ttacgaatcg ccgtcctgat agtgaccggt       120
     ttggtcacgc tgcagtcggt gcttctggtg gctggtgcgt ggcgcaatga cattgcgatc       180
     caacgtaata tgggggtcgc gcaggctgag gtgctcagcg ccgggccgcg gcgttcgacg       240
     atcgagtttg tcacaccgga tcggatcacc tatcggccgc aactcggtgt gctgtatccg       300
     tccgaattat ccacgggcat gcgaatttac gttgagtaca acaagaggga tcccaacctg       360
     gtcagagtgc agcaccgtaa cgccggactg gcgatcatcc cggccgggtc catcgcggtg       420
     gtggcctggc tgatcgccgc cgccgcgctg gtcgtgctag cggtgctgga caagcggttg       480
     gaacgtcgtg aaaattcggc gtctgcaacg ggctga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page