(data stored in ACNUC1104 zone)

EMBL: CP000717.PE573

CP000717.PE573       Location/Qualifiers
FT   CDS_pept        657107..657967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10573"
FT                   /old_locus_tag="TBFG_00564"
FT                   /product="protease transmembrane protein heat shock protein
FT                   htpX"
FT                   /note="Mapped to H37Rv Rv0563"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10573"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04916"
FT                   /protein_id="ABR04916.1"
FT                   /translation="MTWHPHANRLKTFLLLVGMSALIVAVGALFGRTALMLAALFAVGM
FT                   NVYVYFNSDKLALRAMHAQPVSELQAPAMYRIVRELATSAHQPMPRLYISDTAAPNAFA
FT                   TGRNPRNAAVCCTTGILRILNERELRAVLGHELSHVYNRDILISCVAGALAAVITALAN
FT                   MAMWAGMFGGNRDNANPFALLLVALLGPIAATVIRMAVSRSREYQADESGAVLTGDPLA
FT                   LASALRKISGGVQAAPLPPEPQLASQAHLMIANPFRAGERIGSLFSTHPPIEDRIRRLE
FT                   AMARG"
     atgacttggc atccgcatgc caaccggctg aagacgttcc tgctgttggt cggtatgtcc        60
     gcgttgatcg tggccgtcgg cgcgttgttt ggcaggacgg cgctgatgct ggcggcgctg       120
     ttcgccgtcg gaatgaacgt ctacgtctac ttcaatagcg acaagctggc gctgcgggcg       180
     atgcatgcgc aaccggtttc cgaactgcag gcgccggcga tgtaccggat cgttcgagag       240
     ctggcgacca gcgctcacca gccgatgccc cggctgtaca tcagcgacac cgccgcaccc       300
     aacgcgttcg ccaccggccg caacccgcgc aatgccgcgg tgtgttgcac gactggcatc       360
     ctgcgtatcc tcaatgagcg tgagctgcgt gccgtgctgg gccacgagct gtctcacgtc       420
     tacaaccgcg acatcctgat ctcttgtgtg gcaggtgcgc tggcagcggt gattaccgcg       480
     ctggccaaca tggccatgtg ggccggcatg ttcggcggca accgagacaa cgccaatccc       540
     tttgcactgc ttctggttgc gctgctgggc ccgatcgcgg caaccgtgat acggatggcc       600
     gtgtcgcgat cgcgggagta ccaggccgac gagtcgggtg ccgtcctgac cggggacccg       660
     ctggcgttgg cgtcggcatt gcgcaagatc tccggcggcg tccaggcggc gccgctgccg       720
     ccggagccgc agctggccag ccaggcgcac ctgatgatcg ccaacccgtt ccgggcgggt       780
     gagcggatcg gatcgctgtt ttcgactcac ccaccgatcg aggaccgcat tcgccggctg       840
     gaggcgatgg cgcgcggctg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page