(data stored in ACNUC1104 zone)

EMBL: CP000717.PE581

CP000717.PE581       Location/Qualifiers
FT   CDS_pept        complement(666715..668046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10581"
FT                   /old_locus_tag="TBFG_00572"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0571c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10581"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04924"
FT                   /protein_id="ABR04924.1"
FT                   /translation="MKLFDDRGDAGRQLAQRLAQLSGKAVVVLGLPRGGVPVAFEVAKS
FT                   LQAPLDVLVVRKLGVPFQPELAFGAIGEDGVRVLNDDVVRGTHLDAAAMDAVERKQLIE
FT                   LQRRAERFRRGRDRIPLTGRIAVIVDDGIATGATAKAACQVARAHGADKVVLAVPIGPD
FT                   DIVARFAGYADEVVCLATPALFFAVGQGYRNFTQTSDDEVVAFLDRAHRDFAEAGAIDA
FT                   AADPPLRDEEVQVVAGPVPVAGHLTVPEKPRGIVVFAHGSGSSRHSIRNRYVAEVLTGA
FT                   GFATLLFDLLTPEEERNRANVFDIELLASRLIDVTGWLATQPDTASLPVGYFGASTGAG
FT                   AALVAAADPRVNVRAVVSRGGRPDLAGDSLGSVVAPTLLIVGGRDQVVLELNQRAQAVI
FT                   PGKCQLTVVPGATHLFEEPGTLEQVAKLACDWFIDHLCGPGPSG"
     atgaagctct ttgacgatcg tggcgacgct ggacgccagt tggcgcaacg cctggcgcag        60
     ctatccggca aggccgtcgt cgtccttggc ttgccgcgcg gcggggtacc ggtggccttt       120
     gaggtcgcca agtcactgca agcgccactc gacgtcctgg tcgtgcgcaa gcttggcgtg       180
     ccgttccaac ccgaattggc tttcggcgcc atcggtgagg acggcgtgcg ggtgctcaac       240
     gacgacgtcg tccgcgggac acacctcgat gctgccgcca tggacgcggt cgaacgcaag       300
     cagctgatcg agctacaacg ccgcgcggaa cgcttccgcc gcgggcgtga ccgcatcccg       360
     ttgaccgggc ggatcgcggt gatcgtcgat gacggcatcg ccaccggagc gacggccaag       420
     gcggcgtgcc aggtcgcccg ggcgcacggt gcggacaagg tggtgctggc ggtcccgatc       480
     ggcccagacg acatcgtggc gagattcgcc gggtacgccg atgaggtggt gtgtttggcg       540
     acgccggcgt tgttcttcgc cgtcgggcaa ggttaccgca acttcaccca gacctccgac       600
     gacgaggtgg tggcgtttct ggatcgtgct caccgcgact tcgccgaggc aggtgcgatc       660
     gatgccgccg ctgacccacc gcttcgcgat gaggaggtcc aggtcgttgc cggtccagta       720
     ccggtggcag ggcacctgac tgtccccgaa aaacccaggg gaattgtggt tttcgcacat       780
     ggcagtggca gcagccggca cagtatccgc aatcggtacg ttgcagaggt cttgaccggg       840
     gccgggtttg cgacgctgtt attcgacttg ctcacgcccg aagaagaacg caaccgcgcc       900
     aacgtcttcg acattgagct gctcgcttcc cgactcatcg acgtgaccgg ttggttggcc       960
     acccagcccg acaccgcatc gctgccggtc ggctacttcg gcgccagcac gggagcgggt      1020
     gcggcgctgg tcgcggccgc cgatccgcgc gtgaacgtgc gggcggtggt gtcccgcggc      1080
     ggccggcccg atctcgcggg tgattcgctg gggagcgtgg tggcaccgac gctgctgatc      1140
     gtgggtggac gcgaccaggt ggtcctcgag ctgaaccaac gagcgcaagc ggtaataccc      1200
     gggaaatgcc aactcaccgt ggtccccggc gccacacacc tattcgaaga accaggcacg      1260
     ctggaacagg ttgccaagct ggcgtgcgat tggttcatcg accacttgtg cggcccaggc      1320
     ccaagcggct aa                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page