(data stored in ACNUC1104 zone)

EMBL: CP000717.PE583

CP000717.PE583       Location/Qualifiers
FT   CDS_pept        complement(669079..670470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10583"
FT                   /old_locus_tag="TBFG_00574"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0573c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10583"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04926"
FT                   /protein_id="ABR04926.1"
FT                   /translation="MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGR
FT                   SYIMAAGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTV
FT                   IFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAH
FT                   GTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLY
FT                   PATMLLVDTYDTLRGVDHVIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLE
FT                   QVEIFASSGLDENRIAALLAARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTK
FT                   FSSGKVIYPGRKQVFRKLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLD
FT                   GARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGA
FT                   KAKRP"
     atggcgatcc gccaacacgt cggcgcgctg ttcaccgacc tgtacgaggt gacgatggcc        60
     caggcctact gggccgaaag aatgtcgggc acagcggttt tcgagatatt cttccgcaag       120
     cttccgcctg gcaggtccta catcatggcc gccgggctgg ccgatgtggt cgagttcctc       180
     gaagcgtttc gattcgacga gcaggatctg cgttacctgc gtggcctggg ccagttttcc       240
     gacgagttcc tgaggtggct ggccggagtg cgtttcaccg gagatgtctg ggccgcgccg       300
     gaaggaaccg tgatttttcc gaacgaaccc gcggtccagc tgatcgcgcc aatcatcgag       360
     gcccagcttg tcgagacgtt tgtgctgaac cagattcatc tgcaaagcgt gctcgcgagc       420
     aaggccgcgc gggtggtcgc cgccgcgcgc ggacgaccgg tggtggattt cggcgcgcgg       480
     cgcgctcacg gcaccgacgc ggcctgcaag gtcgcgcgca ccagttatct cgcgggcgct       540
     gcgggcacgt cgaatctgct cgcggcccgc caatatggga tcccgacgtt cggcaccatg       600
     gcgcacagct ttgttcaagc cttcgacagt gaggtggccg cgttcgaggc gttcgcccgg       660
     ctctacccag ccaccatgct gctcgtggac acctacgaca cgctacgcgg cgtcgatcac       720
     gtcatcgagt tggccaagcg gctgggcaat cgcttcgatg tgcgcgcggt ccggctggat       780
     tccggcgacc tcgatgagct gtccaaggcg acccgtgcac ggctcgacac cgccggtctc       840
     gagcaggtcg agatcttcgc gtcgtcgggc ctcgacgaaa accgcatcgc cgcgcttttg       900
     gctgcccgct gtccgatcga cggcttcggc gtgggcaccc agctcgtcgt ggctcaagac       960
     gcgcccgcgc tggacatggc ctacaagctg gtggcatacg acggcagcgg gcgcaccaag      1020
     ttctccagcg gcaaggtgat ctacccggga cgcaagcagg tgttccgtaa gctcgagcac      1080
     ggagtctttt gcggcgacac gctcggcgag cacggtgaaa accttcccgg ggacccgttg      1140
     ctggtgccca tcatgaccaa cggccgacgc atccggcagc atgcacccac attggacggc      1200
     gcgcgggact gggcccgcca gcagatcgac gcgctcccgc cggagctgcg ctcgctcgag      1260
     gacaccggct actcgtatcc ggtggcggtc agcgacagga tcgtgggcga actcgcccgg      1320
     ctgcggcacg ccgacacggc cgaagcccac cccgggtcca acgtcgtcgg ggcgaaggcc      1380
     aaacgaccct ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page