(data stored in ACNUC1104 zone)

EMBL: CP000717.PE584

CP000717.PE584       Location/Qualifiers
FT   CDS_pept        complement(670480..671622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10584"
FT                   /old_locus_tag="TBFG_00575"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0574c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10584"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04927"
FT                   /protein_id="ABR04927.1"
FT                   /translation="MAGNPDVVTVLLGGDVMLGRGVDQILPHPGKPQLRERYMRDATGY
FT                   VRLAERVNGRIPLPVDWRWPWGEALAVLENTATDVCLINLETTITADGEFADRKPVCYR
FT                   MHPDNVPALTALRPHVCALANNHILDFGYQGLTDTVAALAGAGIQSVGAGADLLAARRS
FT                   ALVTVGHERRVIVGSVAAESSGVPESWAARRDRPGVWLIRDPAQRDVADDVAAQVLADK
FT                   RPGDIAIVSMHWGSNWGYATAPGDVAFAHRLIDAGIDMVHGHSSHHPRPIEIYRGKPIL
FT                   YGCGDVVDDYEGIGGHESFRSELRLLYLTVTDPASGNLISLQMLPLRVSRMRLQRASQT
FT                   DTEWLRNTIERISRRFGIRVVTRPDNLLEVVPAANLTSKE"
     gtggctggca atcctgatgt ggtgacggtg ctgctgggcg gtgacgtcat gctcggccgt        60
     ggcgtcgatc agatcctgcc tcatcccggc aaaccgcaat tgcgcgaacg gtatatgcgg       120
     gatgcgaccg gctatgttcg cctggccgag cgggtgaacg ggcgcattcc gctccccgtg       180
     gattggcgct ggccctgggg cgaggcgttg gcggtccttg agaacaccgc gaccgacgtc       240
     tgtttgatca atctggagac gacgatcacc gccgacggtg aattcgccga ccgcaaaccg       300
     gtctgctacc ggatgcaccc ggataacgtg ccggcgctga cggcattgcg gccgcacgtg       360
     tgcgcgctgg ccaacaacca cattctcgat ttcggctacc aggggctgac cgatacggtc       420
     gcggctctcg ccggtgcggg gatccagagt gtcggggcgg gagccgattt gctcgccgct       480
     cgccgctcgg cgctagtcac ggttggccat gaacgccggg tgatcgtcgg ctcggtagcg       540
     gcggaatcca gcggcgtccc cgaatcctgg gccgcccgcc gcgaccggcc cggagtgtgg       600
     ttgatccggg atccggcgca acgcgacgtc gccgacgatg tggcggcaca ggtgctggcg       660
     gacaaacgcc ccggcgatat cgccatagtc tcgatgcatt ggggatccaa ttggggctat       720
     gcgaccgcac ccggcgacgt cgcgttcgcg caccgactga tcgacgccgg catcgacatg       780
     gtccacggac attcctcgca ccatccgcgg ccaatcgaga tatatcgcgg taaaccgatc       840
     ctgtacggat gcggtgacgt cgttgacgac tacgaaggca tcggcgggca cgagtcgttc       900
     cgcagtgaac tgcgactgct gtatctgacc gtcaccgatc ccgccagcgg gaacctgatc       960
     tcgctgcaga tgcttccact gcgagtgtcg cggatgcgcc tacagcgtgc ctcccagacc      1020
     gacaccgaat ggctccgcaa caccattgag cgcatcagcc gccggttcgg gattcgagtc      1080
     gtgactcgac ccgacaacct gctggaggtc gttcccgctg ccaacctaac gagcaaggag      1140
     taa                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page