(data stored in ACNUC1104 zone)

EMBL: CP000717.PE589

CP000717.PE589       Location/Qualifiers
FT   CDS_pept        679059..679538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10589"
FT                   /old_locus_tag="TBFG_00580"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0577"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10589"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04931"
FT                   /protein_id="ABR04931.1"
FT                   /translation="MAAVIVEPIFAKSVAAVVSISGVAITNDISLPRSGQPGVARRGKE
FT                   LCGYPGDLPCGANLRDPNSNDPLLTLSSKGQNPKLYANELSTVHPRFPSTRANGQTSTV
FT                   LAPRRYCRSSSRSRPGARTPLPSRDPAGEDKEWSAMWMSGHTPSSTSSWSCRRAV"
     ttggccgcag tgatcgtcga accaattttc gccaaatccg ttgccgccgt ggtcagcatc        60
     tccggcgtcg cgattacgaa cgacatctcg ctccccaggt caggtcagcc cggtgttgcc       120
     cggcgtggca aggaattgtg tggctatccc ggcgatctac catgtggagc gaatcttcgg       180
     gatcccaact ccaacgatcc cttgttgacg ctatcgtcaa aagggcaaaa ccccaaactt       240
     tacgcgaacg aactatccac agtgcaccct cgatttccgt cgacacgtgc aaacggccag       300
     acctcgacgg tgctagcccc gcggcgatat tgcaggtctt cgagccggtc gcgccccggg       360
     gcgcgaactc cgttgccctc ccgcgaccct gcgggagagg ataaggaatg gtcggctatg       420
     tggatgtccg ggcatacgcc gagctcaacg agttcgtgga gctgcaggcg cgcggtctga       480
//

If you have problems or comments...

PBIL Back to PBIL home page