(data stored in ACNUC1104 zone)

EMBL: CP000717.PE59

CP000717.PE59        Location/Qualifiers
FT   CDS_pept        64013..65071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10059"
FT                   /old_locus_tag="TBFG_00059"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0060"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04402"
FT                   /protein_id="ABR04402.1"
FT                   /translation="MITYGSGDLLRADTEALVNTVNCVGVMGKGIALQFKRRYPEMFTA
FT                   YEKACKRGEVTIGKMFVVDTGQLDGPKHIINFPTKKHWRAPSKLAYIDAGLIDLIRVIR
FT                   ELNIASVAVPPLGVGNGGLDWEDVEQRLVSAFQQLPDVDAVIYPPSGGSRAIEGVEGLR
FT                   MTWGRAVILEAMRRYLQQRRAMEPWEDPAGISHLEIQKLMYFANEADPDLALDFTPGRY
FT                   GPYSERVRHLLQGMEGAFTVGLGDGTARVLANQPISLTTKGTDAITDYLATDAAADRVS
FT                   AAVDTVLRVIEGFEGPYGVELLASTHWVATREGAKEPATAAAAVRKWTKRKGRIYSDDR
FT                   IGVALDRILMTA"
     atgatcacgt acggctctgg cgacctcctt cgggctgaca ccgaagcgct cgtcaacacc        60
     gtcaactgtg ttggggtgat gggcaaggga attgcgctgc agttcaaacg ccgctacccc       120
     gagatgttca ccgcctacga aaaggcgtgc aaacgcggcg aagttaccat cggcaagatg       180
     ttcgtcgtcg acaccggaca gctcgacgga ccgaaacaca tcatcaactt ccccaccaag       240
     aaacactggc gtgcaccgtc gaagctggcc tatatcgacg ccggcctcat tgatctcatc       300
     cgcgtgatcc gtgaactcaa cattgcttct gtggcagttc ccccgctggg ggtgggcaac       360
     ggaggtctgg attgggaaga tgtcgagcaa cggctcgtat cagcattcca gcagctgccc       420
     gacgttgacg ccgtgatcta ccccccatca ggtggatctc gcgccatcga gggcgtcgaa       480
     ggacttcgga tgacctgggg gcgcgccgtc atactcgaag cgatgcggcg atatctccag       540
     cagcgccgcg cgatggagcc gtgggaagac cctgcaggga tctcgcatct ggagattcag       600
     aagctcatgt acttcgccaa cgaggccgat cccgatcttg cgctagattt cacgcccggc       660
     cgatacgggc catacagcga acgtgtccgt cacttactgc aaggaatgga gggcgcattc       720
     acagtcggcc tgggtgacgg caccgcaaga gttcttgcga accaaccgat ctcgttgact       780
     actaagggaa ctgacgccat aacggactat ctggccaccg atgcggcagc tgaccgggtg       840
     agcgccgcag tcgacacggt gttgcgcgtc atcgaaggct ttgaaggccc atacggggtt       900
     gagctgctcg ccagtacgca ttgggtggcc acacgtgagg gcgccaagga accagccacg       960
     gcagcggccg cggtccgaaa gtggacaaaa cgcaagggtc ggatctacag cgacgatcgc      1020
     atcggtgttg ccctcgaccg cattcttatg actgcctga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page