(data stored in ACNUC1104 zone)

EMBL: CP000717.PE590

CP000717.PE590       Location/Qualifiers
FT   CDS_pept        679466..680224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10590"
FT                   /old_locus_tag="TBFG_00581"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0579"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10590"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04933"
FT                   /protein_id="ABR04933.1"
FT                   /translation="MVGYVDVRAYAELNEFVELQARGLTVRRPFRSHQTVKDVLEAMGI
FT                   PHTEVDLILVNGDPADFSYRPVAGDRIAAYPMFEALDIGSTARLRPAPLRNPRFVVDVN
FT                   LGQLARLLRLLGFDTRWSSAADDPTLADISLGEQRILLTRDRGLLKRRAITHGLFVHSQ
FT                   HPEEQALEVLRRLDLNGRLAPLSRCLRCNGELAAVSKDEVIGQLEPLTRRYYESFSRCF
FT                   GCGRIYWPGSHHARLVRLVERLRDQLTTST"
     atggtcggct atgtggatgt ccgggcatac gccgagctca acgagttcgt ggagctgcag        60
     gcgcgcggtc tgacggtgcg ccggccgttc cgcagccatc agacggtcaa agatgtgctg       120
     gaggcgatgg gcattccgca taccgaggtg gatctcatcc tggtgaacgg cgatcccgcg       180
     gacttttcct accggccggt cgccggcgac cgcattgccg cctaccctat gttcgaggcc       240
     ctcgacatcg ggtcgaccgc caggttgcgc ccagcgccgt tgcgtaaccc gcgcttcgtc       300
     gtcgacgtca acctcggcca gctggcgcgg ctgcttcggc tgttgggctt cgacacacgg       360
     tggtcgagtg ccgccgatga tccgacgctg gccgatatca gcctgggcga gcagcgaatt       420
     ctgctgaccc gcgaccgcgg cctgttgaag cgccgggcaa tcacccatgg tctgttcgtc       480
     cactcccagc acccggagga gcaggcgctc gaggtgctgc ggcggctaga cctcaacggg       540
     cggctggcac cgctatcccg gtgtctgcga tgcaatggtg agctggccgc ggtttccaaa       600
     gacgaggtga ttggccagct ggagccgttg acccgccggt actacgagtc attcagccgc       660
     tgcttcggtt gcgggcggat ctactggccg ggatcacacc acgcacggtt ggttcgcctc       720
     gtcgaacgac tgcgggacca gctaactact tcgacctga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page