(data stored in ACNUC1104 zone)

EMBL: CP000717.PE591

CP000717.PE591       Location/Qualifiers
FT   CDS_pept        complement(680353..680931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10591"
FT                   /old_locus_tag="TBFG_00582"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0580c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10591"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04934"
FT                   /protein_id="ABR04934.1"
FT                   /translation="MVLPVAPYILLRHQLVGVAANPDRIYGEGMTDQSYAVDIAHPPAA
FT                   LLRLVNPILRSLLHTPLAGPLRTQLMVVSFTGRKTGRHFSIPLSAHVIDNDLYALTEAG
FT                   WKHNFSDGAAAQVVYDGKTTAMRGELIRDRAVVSELFLRAAQAYGVKRGQRMLGLSFRD
FT                   RRIPTLEEFAEAVDRLKLVAIRLTPADNS"
     atggtactac cggtggcgcc atatatcttg ttgcgtcacc aacttgtcgg cgtagccgcg        60
     aaccccgatc ggatctacgg tgaaggcatg acagatcagt cgtatgcggt agacatcgca       120
     cacccaccgg cggccctcct tcgcctcgtc aacccgatcc tgcgctccct gctgcacacc       180
     ccgcttgccg gcccgctacg cacacagctg atggtggtga gcttcaccgg gcgaaagact       240
     gggcggcact tctcgattcc cttgagcgcg cacgtcatcg acaacgacct ctacgcgctg       300
     accgaggccg gatggaagca caacttctcc gacggtgccg ccgcccaggt cgtctacgac       360
     ggcaagacga ccgctatgcg tggcgagctc atccgggacc gtgcggtcgt ttctgaactt       420
     ttcctgcgcg ccgcacaggc ctatggcgtc aagcgtggcc aacgcatgct ggggttgagc       480
     ttccgcgacc ggcgcatacc cacgctcgag gagttcgccg aggcggtgga ccggctcaag       540
     ctggtagcca ttcggttgac tccggccgac aattcgtag                              579
//

If you have problems or comments...

PBIL Back to PBIL home page