(data stored in ACNUC1104 zone)

EMBL: CP000717.PE592

CP000717.PE592       Location/Qualifiers
FT   CDS_pept        680938..681153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10592"
FT                   /old_locus_tag="TBFG_00583"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0581"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10592"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04935"
FT                   /protein_id="ABR04935.1"
FT                   /translation="MDKTTVYLPDELKAAVKRAARQRGVSEAQVIRESIRAAVGGAKPP
FT                   PRGGLYAGSEPIARRVDELLAGFGER"
     gtggacaaga cgacggtcta cctgccggat gaactcaagg cggccgtgaa gcgcgccgct        60
     cggcagcgcg gagtctccga agcgcaggta atccgggagt ccatccgggc ggcggtcggc       120
     ggcgccaagc cgccgccgcg cgggggtcta tatgcgggtt cggagcccat cgcgcggcga       180
     gtcgacgagc tgctggctgg cttcggtgag cggtga                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page