(data stored in ACNUC1104 zone)

EMBL: CP000717.PE599

CP000717.PE599       Location/Qualifiers
FT   CDS_pept        689156..690043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10599"
FT                   /old_locus_tag="TBFG_00590"
FT                   /product="hypothetical integral membrane protein yrbE2B"
FT                   /note="Mapped to H37Rv Rv0588"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10599"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04942"
FT                   /protein_id="ABR04942.1"
FT                   /translation="MVESSTASAAAVLRARYPRTAASLDRYGGGTARRLERTGTFARFT
FT                   RISVVQIGWALRRYRRETLRLVAEIGMGTGAMAVVGGTVAIIGFVTLSGGSLIAIQGFA
FT                   SLGNIGVEAFTGFFAALANTRVAAPIVSGVALAATVGAGATAQLGAMRISEEIDALEVM
FT                   GIKSISFLVSTRILGGLVVIMPLYALALDMAFTSGQVVTTVFYGQSNGTYEHYFRTFLR
FT                   PEDVGWSVVEVVIIAVVVMITHCYYGYTASGGPVGVGQAVGRSMRFSLVSVVVVVLLAE
FT                   LALYGVDPNFNLTV"
     atggtggagt cttcaacggc atcagcggca gccgtattgc gggcccgcta cccacgcaca        60
     gccgccagcc ttgaccgcta cggcggcggc acggcccgaa gacttgagcg gacagggact       120
     ttcgcgagat tcacccggat cagcgtcgtg cagatcggct gggcactgcg tcgctatcgc       180
     cgggagacgc tgcgcctggt cgccgagatc gggatgggca ccggcgcgat ggccgtcgtc       240
     ggcggcacgg tcgcgatcat cggttttgtg acgctgtccg gcggctcgct gatcgccatc       300
     cagggcttcg cgtcgctggg caacatcggt gtcgaggcgt ttaccggatt ctttgccgca       360
     ctggccaaca cacgcgtcgc tgcgcccatt gtctccggtg tcgcgctggc cgcgacggtg       420
     ggcgccggcg ccaccgcaca gttaggtgcc atgcggatca gtgaggagat cgacgcgctg       480
     gaagtgatgg gcatcaagtc gatttcgttt ctggtctcca ctcggattct aggagggctg       540
     gtggtgatca tgccgctgta cgcgctcgct ctcgacatgg ctttcacctc tggtcaggtg       600
     gtcacaaccg tgttctacgg ccagtccaac ggcacctatg agcactactt ccgcaccttc       660
     ctgcgcccag aggatgtggg ttggtcggtc gtggaggtgg tgatcatcgc ggtggtggtg       720
     atgatcaccc attgctacta cgggtacacc gccagcggtg gcccggttgg ggtcggccag       780
     gcggttggtc gatcgatgcg tttctcgctg gtctcggtgg tggtcgttgt cctgctggcc       840
     gagttggcgc tctacggcgt cgacccgaac ttcaatctca cggtgtag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page