(data stored in ACNUC1104 zone)

EMBL: CP000717.PE603

CP000717.PE603       Location/Qualifiers
FT   CDS_pept        692287..693732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10603"
FT                   /old_locus_tag="TBFG_00594"
FT                   /product="MCE-family protein mce2C"
FT                   /note="Mapped to H37Rv Rv0591"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10603"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04946"
FT                   /protein_id="ABR04946.1"
FT                   /translation="MRTLTEFNRGRVGMMGAVVTVLVVGVAQSFTSVPMLFATPTYYAQ
FT                   FADTGGINTGDKVEIAGVNVGLVRSLAIRGNRVLIGFSLPGKTIGMQSRAAIRTDTILG
FT                   RKNLEIEPRGSEPLKPNGFLPLAQTTTPYQIYDAFVDVTKAATGWDIDAVKRSLNVLSE
FT                   TFDQTAPHLSAALEGVKAFSDTVGRRGEQIEQLLANANRIARVLGDRSEQVNGLLVNAK
FT                   TLLAAFKQRSQALRILLTNVSEASAQVSGLITDNPNLNHVLAQLRTVSEELVKRKNELA
FT                   DVAVLLGRYTAALTEAVGSGPFFKAMVVNLLPYQILQPWVDAAFKKRGIDPENFWRSAG
FT                   LPEFRWPDPNGTRFPNGAPPAAPPVREGTPKHPGPAVPPGTPCSYTPAAGALPRPDTPL
FT                   PCAGATVGPFGGPDFPAPLDVQPSPPNPDGPPPTPGILSAGRPGEPAPAVPGIPMPLPP
FT                   NAPPGARTQPLEPFPDGTGGSNQ"
     atgagaacgc tgaccgagtt caaccgcggc cgtgtcggga tgatgggtgc ggtggtcacg        60
     gtgctcgtcg ttggtgttgc gcaaagcttc accagcgtgc cgatgctgtt cgccacacct       120
     acctactatg cgcaattcgc cgacacgggt ggcatcaaca cgggcgataa ggtggaaatc       180
     gctggggtga acgtcgggct ggtgcgctcg ctggcaatcc gcggcaaccg cgtgttgatc       240
     ggattctcgt tgcccggcaa gacaatcggg atgcaaagcc gggcagcaat tcgcaccgac       300
     accattcttg gccgtaagaa cctggagatc gaaccccgcg gttcggagcc gttgaaaccc       360
     aacggtttcc tgccgttggc gcagaccact acgccatacc aaatctatga cgcgttcgtc       420
     gatgtcacga aggcggcgac gggctgggac atcgatgccg tcaaacgctc gctaaacgtg       480
     ttgtcggaga cattcgatca gaccgccccg catctaagtg ccgccctcga gggtgtcaag       540
     gcattctccg acaccgtcgg ccggcgcggc gagcagatcg agcaactgct ggcgaacgcc       600
     aacaggatcg cgcgcgtgct cggcgaccgc agcgagcagg tcaacgggct gctggtgaat       660
     gccaagacgc tgctggccgc gttcaagcaa cgcagccagg cactgcgcat tctgctaacc       720
     aacgtgtcgg aggcatcagc ccaggtatct ggcctgatca cagacaaccc caacctcaac       780
     catgtgctgg cccagttgcg cacggtcagc gaggagctgg tgaagcgcaa gaacgaattg       840
     gccgatgtag ccgtcttgct cggcagatac accgcggccc tgacagaggc cgtcggttcc       900
     ggaccgttct tcaaggcgat ggtggtcaat ctgctgccct accagattct tcagccctgg       960
     gttgacgcgg cgttcaaaaa gcggggcatc gacccggaga acttctggcg cagtgcgggt      1020
     ctgccggaat tccgctggcc cgaccccaac ggcacccggt tccccaacgg cgcgccgccg      1080
     gcggcgccac cggtgcggga gggtacaccc aagcatccgg gaccggccgt cccgccggga      1140
     acgccgtgct cctacacacc ggcggcgggc gcgttgccac ggcccgacac cccactaccc      1200
     tgcgcgggcg ccaccgttgg cccgttcggt ggacccgact tcccggcacc gctcgatgtc      1260
     cagccgtcgc cgcctaatcc cgatgggccg ccgccgacgc cgggcatcct aagtgctggg      1320
     cggccgggcg agccggctcc ggctgttccg ggcataccga tgccgctgcc gccgaacgcg      1380
     ccgccgggtg cacgcaccca accgctggag ccgtttcctg acgggacggg aggtagcaac      1440
     caatga                                                                 1446
//

If you have problems or comments...

PBIL Back to PBIL home page