(data stored in ACNUC1104 zone)

EMBL: CP000717.PE604

CP000717.PE604       Location/Qualifiers
FT   CDS_pept        693729..695255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10604"
FT                   /old_locus_tag="TBFG_00595"
FT                   /product="MCE-family protein mce2D"
FT                   /note="Mapped to H37Rv Rv0592"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10604"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04947"
FT                   /protein_id="ABR04947.1"
FT                   /translation="MSTIFDIRSLRLPKLSAKVVVVGGLVVVLAVVAAAAGARLYRKLT
FT                   TTTVVAYFSEALALYPGDKVQIMGVRVGSIDKIEPAGDKMRVTLHYSNKYQVPATATAS
FT                   ILNPSLVASRTIQLSPPYTGGPVLQDGAVIPIERTQVPVEWDQLRDSINGILRQLGPTE
FT                   RQPKGPFGDLIESAADNLAGKGRQLNETLNSLSQALTALNEGRGDFVAITRSLALFVSA
FT                   LYQNDQQFVALNENLAEFTDWFTKSDHDLADTVERIDDVLGTVRKFVSDNRSVLAADVN
FT                   NLADATTTLVQPEPRDGLETALHVLPTYASNFNNLYYPLHSSLVGQFVFPNFANPIQLI
FT                   CSAIQAGSRLGYQESAELCAQYLAPVLDALKFNYLPFGSNPFSSAATLPKEVAYSEERL
FT                   RPPPGYKDTTVPGIFSRDTPFSHGNHEPGWVVAPGMQGMQVQPFTANMLTPESLAELLG
FT                   GPDIAPPPPGTNLPGPPNAYDESNPLPPPWYPQPASLPAAGATGQPGPGQ"
     atgagcacca tcttcgacat ccgcagcctg cgactgccga aactgtctgc aaaggtagtg        60
     gtcgtcggcg ggttggtggt ggtcttggcg gtcgtggccg ctgcggccgg cgcgcggctc       120
     taccggaaac tgactaccac taccgtggtc gcgtatttct ctgaggcgct cgcgctgtac       180
     ccaggagaca aagtccagat catgggtgtg cgggtcggtt ctatcgacaa gatcgagccg       240
     gccggcgaca agatgcgagt cacgttgcac tacagcaaca aataccaggt gccggccacg       300
     gctaccgcgt cgatcctcaa ccccagcctg gtggcctcgc gcaccatcca gctgtcaccg       360
     ccgtacaccg gcggcccggt cttgcaagac ggcgcggtga tcccaatcga gcgcacccag       420
     gtgcccgtcg agtgggatca gttgcgcgat tccatcaatg ggatcctccg ccagctcggc       480
     ccgacggagc ggcagccgaa ggggccgttc ggcgacctca tcgaatcggc cgcggacaac       540
     ctggccggca agggcaggca gctcaacgaa acgctgaaca gtttgtcgca ggcgttgacc       600
     gcgctgaacg agggccgggg agacttcgtt gcgatcacgc gaagcctggc gctatttgtc       660
     agcgcgctct accagaatga tcaacagttc gttgcgctca acgaaaacct tgccgagttc       720
     accgactggt tcaccaaatc cgaccatgac ttggccgaca cggtggaacg gatcgacgac       780
     gttctcggca ccgtccgaaa gttcgtgagc gacaacagat ccgtgctggc tgccgatgtc       840
     aacaacctcg ccgacgcgac cactacacta gtgcaacccg agccgcggga cggtctggaa       900
     accgcgttgc acgtgttgcc gacctacgcc agcaacttca acaaccttta ctatccactg       960
     cacagctctc tggtgggcca gttcgtgttc cccaacttcg cgaacccaat tcagctcatt      1020
     tgcagcgcta ttcaggccgg cagccgactc ggctatcagg aatccgccga gctgtgcgcg      1080
     cagtacttgg caccggttct ggacgctctc aagttcaatt acttgccgtt cggctcaaac      1140
     ccgttcagtt cggcggccac tttgcccaag gaggtggctt actccgagga gcggctccgc      1200
     ccgccgcccg ggtacaagga caccactgtc ccagggatct tctcgcggga cacaccgttt      1260
     tcacacggca accatgaacc gggctgggtc gttgcgcccg ggatgcaggg tatgcaggtt      1320
     cagccgttta ccgcgaacat gctcaccccg gaatcgctgg cagagctgct gggtggtccg      1380
     gatattgccc ccccgccgcc gggaaccaac ttgcccggac cgccgaatgc gtatgacgag      1440
     tccaatccgt tgccgccgcc gtggtacccg cagcccgcgt ccctcccggc tgcgggcgcc      1500
     acaggacagc caggcccggg ccagtga                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page