(data stored in ACNUC1104 zone)

EMBL: CP000717.PE606

CP000717.PE606       Location/Qualifiers
FT   CDS_pept        696465..698015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10606"
FT                   /old_locus_tag="TBFG_00597"
FT                   /product="MCE-family protein mce2F"
FT                   /note="Mapped to H37Rv Rv0594"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10606"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04949"
FT                   /protein_id="ABR04949.1"
FT                   /translation="MLTRAIKTQLVLLTVLAVIAVVVLGWYFLRIPSLVGIGRYTLYAE
FT                   LPRSGGLYRTANVTYRGITIGKVTGVEPTERGARATMSIDNGYQIPTDASANVHSVSAV
FT                   GEQFVDLVSTRTSGPYLRHGQTITTTTVPSQIGPALDAANRGLAVLPKDRVASVLHEAS
FT                   EAVGGLGSSLNRLIEATQAIAHDVRGSLEDIDDIIERSAPIIDSQVNSGNEIARWAANL
FT                   NTLAAQTAQTDPAVRSILANAAPTADQVNATFSDVRESLPQTLANLEVVIDMLKRYHNG
FT                   VEQALVFLPQSGAIAQSVTTEFPGQAGLGVGGLALNQPPPCLTGFLPASEWRSPADTST
FT                   APLPKGTYCRIPMDASNVVRGARNNPCVDVPGKRAATPRECRSNEAYVPGGTNPWYGDP
FT                   NQMLSCPAPAARCDQPVKPGQVIPAPSVNNGINPLPADQLPGTPPPVNDPLQRPGSGTV
FT                   QCNGQQPNPCVYTPSTFPTTIYDVQSGKVVAPDGVVYSVEASTHAGADGWKVMLAPTG"
     atgctgactc gcgctatcaa gacccagctg gtgttgttga cggtgttggc ggtcatcgcg        60
     gtggtggtcc ttggttggta tttcctgcgg atacccagcc tggtcggcat cggtcgatac       120
     acgctttatg ccgaattgcc tcggtccggg ggtctatacc gaacagccaa cgtcacatat       180
     cggggcatca ccatagggaa ggtcaccggc gtcgaaccaa ccgagcgggg cgcgcgagca       240
     accatgagca tcgacaatgg ctaccagatc cccaccgacg cctcggccaa tgtgcactca       300
     gtgtcggcgg tcggcgagca gttcgttgac ctggtgtcga cccgcaccag cggtccgtat       360
     ctgcggcatg ggcagacgat caccacgact acggtcccca gccagattgg cccggcgctg       420
     gacgccgcca accgtggatt ggcagtgctg cccaaagacc gggtcgcgtc ggtgctgcac       480
     gaggcgtcgg aggccgtggg cgggctggga tcctcactga atcgcctcat cgaagccacc       540
     caggcaatcg cccacgatgt caggggcagc ctcgaggaca tcgacgacat catcgagcgt       600
     tcggcgccta tcatcgatag ccaggtcaat tccggcaacg agatcgcccg ctgggccgcc       660
     aacctcaaca cgctggccgc tcagaccgcg cagaccgatc cggcggtgcg aagcattctg       720
     gccaacgcgg caccgactgc cgatcaggtc aacgccacgt tcagcgacgt gcgggagtcg       780
     ttgccgcaga cgctggccaa tctcgaggtc gtaatcgata tgctcaagcg ctaccacaac       840
     ggcgtcgagc aggcgttggt gttcttgccg cagtccggcg cgatcgccca gtcggttact       900
     acagagttcc ccggccaggc cggactgggt gtcggcggcc tggcgctcaa ccaaccaccg       960
     ccgtgcctga ccggcttcct gccggcgtcg gagtggcggt cacctgctga caccagcacc      1020
     gcaccgctac ccaagggcac ctactgcagg attccgatgg acgcgagcaa tgtggttcgt      1080
     ggagcacgca acaacccgtg tgtagacgtg cccggcaagc gggcggcgac cccgcgggaa      1140
     tgccgcagca atgaagctta tgtgcccggg ggcaccaatc cctggtatgg ggaccccaac      1200
     cagatgctca gctgtcccgc gccggccgcg cgttgtgacc agccggtgaa gccaggccag      1260
     gtgatcccgg cgccgtcagt taacaatggc atcaacccgc tgcccgccga tcagctgcca      1320
     ggcacacctc caccggtcaa cgatcctttg cagcgacctg ggtcaggcac cgtccagtgc      1380
     aatgggcaac aacccaaccc gtgcgtctac accccgagca catttcctac aaccatttac      1440
     gacgtgcaga gcggcaaagt cgtagcaccc gacggtgtgg tgtattccgt tgaggcttcg      1500
     actcatgccg gagccgacgg atggaaggtg atgctggcac caaccggctg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page